SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_034_00421.2|PACid:22056700 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_034_00421.2|PACid:22056700
Domain Number - Region: 152-273
Classification Level Classification E-value
Superfamily Caspase-like 0.0068
Family Caspase catalytic domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_034_00421.2|PACid:22056700
Sequence length 320
Sequence
MRAQMAWNFSELKVRKKKLLLLLLVFFALSASNNFSISNASTMHTNNWAVLVCTSRFWFN
YRHMANTLSLYRTVKRLGIPDERIILMLADDMACNSRNKYPAEVFNNENHRLNLYGDNVE
VDYRGYEVTVENFLRVLTGRHENAVPRSKRLLSDEGSHILLYMTGHGGDEFLKFQDSEEL
QSHDLADAVKQMKEKLRFKELLIMVDTCQAATLFNQLHSPGVLAIGSSMKGENSYSHHLD
SDVGVSVVDRFTFYTLAFFERLNTYSNASLSSLFNSYHPSALMSTAYYRTDLYQRPLDTS
WKQFIPSLLTEGSRAKSLAM
Download sequence
Identical sequences A0A2G5CZY9
Aquca_034_00421.2|PACid:22056700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]