SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_035_00010.3|PACid:22061056 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_035_00010.3|PACid:22061056
Domain Number - Region: 83-153
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0149
Family Polyphosphate kinase C-terminal domain 0.04
Further Details:      
 
Domain Number - Region: 32-57
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0706
Family Ypt/Rab-GAP domain of gyp1p 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_035_00010.3|PACid:22061056
Sequence length 243
Sequence
MLFHYDGNVDAWNDLHWSSKAVHILAHNQTKWWFAKRFLHPDVVFIYDYIFLWDEDLGVT
NFDPGRFLEIMASEGLEISQPALDPNSSEVHHRITIRNRREKVHRRVYAVQGSLNCSEES
TGPPCTGWIEGMAPVFSRAAWRCLWHLIQNDLIHGWGLDMKLGYCAQGDRTEKVGVIDSE
YVVHHGIPSLGGPSENKTPAVRSLDLRTHVRRQSTAELEVFQKRWEEAVRNDEGWDDPFD
NMK
Download sequence
Identical sequences A0A2G5CVN4
Aquca_035_00010.3|PACid:22061056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]