SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_035_00050.3|PACid:22061285 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_035_00050.3|PACid:22061285
Domain Number 1 Region: 367-433
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000322
Family B3 DNA binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_035_00050.3|PACid:22061285
Sequence length 518
Sequence
MNEARVKTSSPSSPTAQTNLSLFSSLLSNSDEDDDLVEKKQNIDPNRERLINEPIQRENP
FPSLFSAPAATVAEYPSMYYLPNFQSGGDNVINSDQSTTDGQNVAAAPFPVMNSQQGFVR
VGNDLTPIFPGLNSSWVPQPVGNPYQYCCFPYNTMCAVPPNLKEKTDDAWISQDPQQMES
QFGHIPVFHGNFLPFQAMLQNPYFPTPVRDTPSSCPLSSFITKSQEVGACATSRGSRDDY
PYVPKPIRGPVLNYTDSATFTDKEEANDNSIDGSSLMPIHKRKLDGPSNMNNTSNTSPLE
GKNNENLEPSARHVIPRWMETNAAEAIQSMRSSRVSTSAEPQSRYPTAADSYKLEEEKEI
EGKDWVLLVQKELRNTDVGNLGRIVLPKKEAEANLPQLVAKDGLILQMEDMIFSIKWKFK
YRYWPNNKSRMYVMENTVYKEKSSGKYIVRGKKGVKSNGDCGKPEEGETEVKKQLSKRRA
LLSANGNVDVKSENGAFAAWERFSLEENNGSSQFIKPL
Download sequence
Identical sequences A0A2G5CVV8
Aquca_035_00050.3|PACid:22061285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]