SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_035_00068.5|PACid:22061007 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_035_00068.5|PACid:22061007
Domain Number 1 Region: 341-400
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 4.01e-17
Family SPT5 KOW domain-like 0.0047
Further Details:      
 
Weak hits

Sequence:  Aquca_035_00068.5|PACid:22061007
Domain Number - Region: 290-328
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000421
Family N-utilization substance G protein NusG, C-terminal domain 0.047
Further Details:      
 
Domain Number - Region: 112-187
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000564
Family SPT5 KOW domain-like 0.097
Further Details:      
 
Domain Number - Region: 570-615
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000722
Family N-utilization substance G protein NusG, C-terminal domain 0.041
Further Details:      
 
Domain Number - Region: 471-499
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00155
Family N-utilization substance G protein NusG, C-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_035_00068.5|PACid:22061007
Sequence length 764
Sequence
MKTKTRMKEKMYEDQEDMEEIERNIRKRYFARADHGDYDEETTDVEQQALLPSVKDPKLW
MVKCAIGHEREAAVCLMQKCIDKGSELQIRSAIALDHLKNYIYIEADKEAHVKEACKGLR
NIYSAKVMLVPIKEMTDVLSVESKAIDLSRDTWVRMKMGNYKGDLAKVVDVDNVRQRVTV
KLIPRIDLQALANKLDGKEVVKKKVVPVQRFMNIAEARKLHIRVERRRDPSTGDYFENIG
GMMFKDGFLFKTVAMKSISTQNIQPTFDELEKFRKPEEDGGDIASFSTLFANRKKGHFMK
GDAVIVVKGDLKNLMGWVEKVEEETVYIIPKMKDLPKTLAVNEKDLCKYFKIGDHVKVVS
GAREGATGMVVKVDGAVLIIVSDSTKEDIRVFADHVVESSEVTTGVTRIGDYELHDLVLL
DNGFGVIIRVESEAFQVLKGNTERPEVAVVKLREIKSKLDKRNSAEDRDKNIISVKDSVR
IVEGPCKGKQGPVEHIYRRVLFINDRHHLEHAGYICAKAQSCKVVGGVANGHRNGHSSDR
FPLRATPQVPPSPRRPPRGGPPTDFGGRGRGGRGHDSRVGSTIKIRLGPFKGYRGRVKDI
NGQTARVELESQMKIVTVNLNQISDNVAISTPYREAPRYGLGSETPMHPSRTPLHPYMTP
LRDPGATPIHDGMRTPMRDRAWNPYAPMSPARDNWEDGNPGSWGSSPQYQEPLLQGHTKP
LLLVQAGQILLVVITMKPEHQGIAAQPMEVHLVLTCHRLLGDSL
Download sequence
Identical sequences A0A2G5CVY6
Aquca_035_00068.5|PACid:22061007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]