SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_035_00068.6|PACid:22061008 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_035_00068.6|PACid:22061008
Domain Number 1 Region: 457-516
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 3.31e-17
Family SPT5 KOW domain-like 0.0047
Further Details:      
 
Weak hits

Sequence:  Aquca_035_00068.6|PACid:22061008
Domain Number - Region: 406-444
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000278
Family N-utilization substance G protein NusG, C-terminal domain 0.047
Further Details:      
 
Domain Number - Region: 228-303
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000414
Family SPT5 KOW domain-like 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_035_00068.6|PACid:22061008
Sequence length 611
Sequence
MPRRRDEDEDLDDDFEEEEEDLGEEEDRGRGSKRRRSEFIDDAAEEDDEEEEEDDDDDED
YGGTRKSTSHKSKKRSGSQFFDLEAAVDTDEDEDEDEGEDDFIVDGGAELQEEDDGRRLH
RRPLMSQYEDQEDMEEIERNIRKRYFARADHGDYDEETTDVEQQALLPSVKDPKLWMVKC
AIGHEREAAVCLMQKCIDKGSELQIRSAIALDHLKNYIYIEADKEAHVKEACKGLRNIYS
AKVMLVPIKEMTDVLSVESKAIDLSRDTWVRMKMGNYKGDLAKVVDVDNVRQRVTVKLIP
RIDLQALANKLDGKEVVKKKVVPVQRFMNIAEARKLHIRVERRRDPSTGDYFENIGGMMF
KDGFLFKTVAMKSISTQNIQPTFDELEKFRKPEEDGGDIASFSTLFANRKKGHFMKGDAV
IVVKGDLKNLMGWVEKVEEETVYIIPKMKDLPKTLAVNEKDLCKYFKIGDHVKVVSGARE
GATGMVVKVDGAVLIIVSDSTKEDIRVFADHVVESSEVTTGVTRIGDYELHDLVLLDNGF
GVIIRVESEAFQVLKGNTERPEVAVVKLREIKSKLDKRNSAEDRDKNIISVKDSVRIVEG
PCKVRLITGLI
Download sequence
Identical sequences A0A2G5CVZ5
Aquca_035_00068.6|PACid:22061008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]