SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_035_00073.2|PACid:22061253 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_035_00073.2|PACid:22061253
Domain Number 1 Region: 576-770,799-963
Classification Level Classification E-value
Superfamily DNase I-like 1.57e-61
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0000261
Further Details:      
 
Domain Number 2 Region: 238-396,464-578
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.48e-24
Family WD40-repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_035_00073.2|PACid:22061253
Sequence length 1158
Sequence
MEENRIEDEDGDVIESLTNSQHPPLPPHRKTHSYSSQQSVSSNLTTTKRNTFRKHSLDET
ANKNIDSFYDSSDDELFPYNKSNSSSVARSGSTGKELQEYLNQFVDPKPLSPPQPLSVPL
SVPDEKDEDGGGDVNRDTGPLPEFIASGGGTGIFKVPLRAAVHPGRPPCLELRPHPFRET
QVGWFLRTIASTENQLWAGQECGVRFWNFEDAYEPGCGIGSRTRRGDEDTAPFHESAPTA
PTLCLIVDAGNRLIWSGHKDGRIKSWKMDQSVDDNNPFKEGFTWHAHRGPVLSMVMTSYG
DVWSGSEGGVVKIWPWEAIEKSLTLTVEERHMASLAVERSYIDLKSQVTYNGVCSISGSD
VRFMLSDNSRGKVWSAGHLSFALWDARTRELLKVFNIEGQIENRVDMSSLPDTSLEDEMK
VKFVSASKKEKSQGTFSFFQRSRNALMGAADAVRRVAAKGAFGDDHRRTEALALTVDGMI
WTGCTNGLLVQWDGNGTRLQEFQHHSSAVQSFCTFGTRIWVGYASGTVQVIDLKGNLLGG
WVAHSSPIIKMAVGAGYVFSLASHGGIRGWSITSPGPIDNILRSELSAKESLYTVFENLK
ILTGTWNVGQGRASHDSLISWLGSVASEVGIIVVGLQEVEMGAGFLAMSAAKETVGLEGS
AIGQWWLDTIGKTLDEGTTFERVGSRQLAGLLISVWVRKNLKPHVGDVDAAAVPCGFGRA
IGNKGAVGLRMRVYDRMICFINCHFAAHLEAVNRRNADFDHVFRTMVFSRPSNLLSSSAG
VSSAVQMIRGANVHAEDGKPELSEADMVVFMGDFNYRLHSISYDEARDFVSQRCFDWLWE
RDQLRAEMKAGKVFQGMREGQILFPPTYKFERHLPGLAGYDAGEKKRIPAWCDRILYRDN
RSTSSSECNLDCPIVSSILQYEARMDVTDSDHKPVRCIFSVDIARVDKSIRRQEFGKIIS
SHEKIRSSLEQLHYIPETIVSTNNIILQNQDMSILRITNKCGNDNVLFGVFCEGQTTVNE
DGQASDHRPRGSFGFPRWLEVTPGTGIIKPGQIVEVSVRHEDFHTLEEFVDGIPQNWWCE
DTRDKEVILVVSVRGSCSIETRNHRVRVRHCFSSKSGRLDSKSNNSKRTPSSVLQRSDVQ
PLNGSSDVVDDLRNLHSP
Download sequence
Identical sequences A0A2G5CVZ6
Aquca_035_00073.2|PACid:22061253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]