SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_035_00073.4|PACid:22061255 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_035_00073.4|PACid:22061255
Domain Number 1 Region: 199-393,456-620
Classification Level Classification E-value
Superfamily DNase I-like 7.3e-61
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0000414
Further Details:      
 
Domain Number 2 Region: 90-198
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000863
Family Quinoprotein alcohol dehydrogenase-like 0.031
Further Details:      
 
Weak hits

Sequence:  Aquca_035_00073.4|PACid:22061255
Domain Number - Region: 693-725
Classification Level Classification E-value
Superfamily PapD-like 0.085
Family MSP-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_035_00073.4|PACid:22061255
Sequence length 815
Sequence
MYNSFPRDARTRELLKVFNIEGQIENRVDMSSLPDTSLEDEMKVKFVSASKKEKSQGTFS
FFQRSRNALMGAADAVRRVAAKGAFGDDHRRTEALALTVDGMIWTGCTNGLLVQWDGNGT
RLQEFQHHSSAVQSFCTFGTRIWVGYASGTVQVIDLKGNLLGGWVAHSSPIIKMAVGAGY
VFSLASHGGIRGWSITSPGPIDNILRSELSAKESLYTVFENLKILTGTWNVGQGRASHDS
LISWLGSVASEVGIIVVGLQEVEMGAGFLAMSAAKETVGLEGSAIGQWWLDTIGKTLDEG
TTFERVGSRQLAGLLISVWVRKNLKPHVGDVDAAAVPCGFGRAIGNKGAVGLRMRVYDRM
ICFINCHFAAHLEAVNRRNADFDHVFRTMVFSRPSNLLSSSGMMRYLFLSCSLACSAYIF
WLVHYFGLPFVLSVAAGVSSAVQMIRGANVHAEDGKPELSEADMVVFMGDFNYRLHSISY
DEARDFVSQRCFDWLWERDQLRAEMKAGKVFQGMREGQILFPPTYKFERHLPGLAGYDAG
EKKRIPAWCDRILYRDNRSTSSSECNLDCPIVSSILQYEARMDVTDSDHKPVRCIFSVDI
ARVDKSIRRQEFGKIISSHEKIRSSLEQLHYIPETIVSTNNIILQNQDMSILRITNKCGN
DNVLFGVFCEGQTTVNEDGQASDHRPRGSFGFPRWLEVTPGTGIIKPGQIVEVSVRHEDF
HTLEEFVDGIPQNWWCEDTRDKEVILVVSVRGSCSIETRNHRVRVRHCFSSKSGRLDSKS
NNSKRTPSSVLQRSDVQPLNGSSDVVDDLRNLHSP
Download sequence
Identical sequences A0A2G5CX05
Aquca_035_00073.4|PACid:22061255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]