SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_035_00079.1|PACid:22061212 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_035_00079.1|PACid:22061212
Domain Number 1 Region: 598-659
Classification Level Classification E-value
Superfamily FF domain 0.00000000000000536
Family FF domain 0.00044
Further Details:      
 
Domain Number 2 Region: 728-795
Classification Level Classification E-value
Superfamily FF domain 0.0000000000000589
Family FF domain 0.0013
Further Details:      
 
Domain Number 3 Region: 658-727
Classification Level Classification E-value
Superfamily FF domain 0.000000000406
Family FF domain 0.0044
Further Details:      
 
Domain Number 4 Region: 889-966
Classification Level Classification E-value
Superfamily FF domain 0.000000000654
Family FF domain 0.0032
Further Details:      
 
Domain Number 5 Region: 430-463
Classification Level Classification E-value
Superfamily WW domain 0.0000000257
Family WW domain 0.0021
Further Details:      
 
Domain Number 6 Region: 378-409
Classification Level Classification E-value
Superfamily WW domain 0.0000000839
Family WW domain 0.0022
Further Details:      
 
Domain Number 7 Region: 830-899
Classification Level Classification E-value
Superfamily FF domain 0.000000209
Family FF domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_035_00079.1|PACid:22061212
Sequence length 1003
Sequence
MSSPAWSPRDTHSTTGITQQVSVSGPTATLISQTSAPSASCVDSQTLKSPSKNASVSFQE
YCLANHSATHHHIAPPPSFSYGAVPKPISTSEISQEASSTPVMKSSPTASNAVIQPPGPG
KSPGTGPSFSYNIVINNNVGSSAGQQFQSNTNASTAALREGGTCIVSSSGSQSLSVAAHS
SLSSSSTAATPNLYPTTMWMPTPSFTAHPGMGGSPATPGPPGIHLSGPFCSNNTVRSMSP
VMPFTATLPPNSVAQQIYPTFQSLPAMAPPPQAHWLQPPQIAGIQRPQYLQYPAMITNPF
PLPVRGQPHPSFSLPDSQPPGISPLGPSGGTSLDSMGSVQHVRSSGMQSELPPPGTDYEK
KADDNGGHITVSNEEAEAWTAHKTDTGAVYYYNAVTGESTYEQPHGYKGEPDKVTVQSTP
VSWDKLGTTDWALVTTDDGKKYYYNNKTKVSSWQVPVEVTEWMKKRHEGDPLRANTMSMQ
NSSMLPEKGPVSISLNTPAINNGGRDATALRPSALPGSSSALDMIKKKLQDPGMPIASSP
LPASSGPSTSDANGLRVVDATVKGPQDEDSKDKQKDANGGGNFSDSSSDSEDVDSGPTKE
ECIIKFKEMLKERRVAPFSKWEKELPKILFDPRFKAIPSHSARRSLFEHYVRTRAEEERK
EKRAAQKAAVEGFRKLLEEASEDIDHKTDYQSFKEKWGSDPRFEALDRKEREVLLNERVL
ALRRAVEEKLQATRAAASSSFKSMLRDKSDITSNTRWSRVKDSLRSDPRYKSVRHEDREL
LFNEYISELRAAEEEVYRATKAKREGQDKLKEREREMRKRKEREEEEVERVRTKVRRNEA
LSSYQALLVETIKDPQASWTESKPKLEKDPQERALNPALEKSDLEKLFREHVKTLYERCA
RDFQALLAEVISTEAATQATEDGKSYLTSWSTAKRILKTDPRYSKMPRKDRESLWWRYAE
EIQRKRKLASDPTDDRLNTEKGCRNSLESVRSPAESRRIRERR
Download sequence
Identical sequences A0A2G5CW07
Aquca_035_00079.1|PACid:22061212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]