SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_035_00079.2|PACid:22061213 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_035_00079.2|PACid:22061213
Domain Number 1 Region: 598-659
Classification Level Classification E-value
Superfamily FF domain 0.00000000000000523
Family FF domain 0.00044
Further Details:      
 
Domain Number 2 Region: 728-795
Classification Level Classification E-value
Superfamily FF domain 0.0000000000000563
Family FF domain 0.0013
Further Details:      
 
Domain Number 3 Region: 658-727
Classification Level Classification E-value
Superfamily FF domain 0.000000000392
Family FF domain 0.0044
Further Details:      
 
Domain Number 4 Region: 863-940
Classification Level Classification E-value
Superfamily FF domain 0.000000000654
Family FF domain 0.0032
Further Details:      
 
Domain Number 5 Region: 430-463
Classification Level Classification E-value
Superfamily WW domain 0.000000024
Family WW domain 0.0021
Further Details:      
 
Domain Number 6 Region: 378-409
Classification Level Classification E-value
Superfamily WW domain 0.0000000804
Family WW domain 0.0022
Further Details:      
 
Weak hits

Sequence:  Aquca_035_00079.2|PACid:22061213
Domain Number - Region: 813-873
Classification Level Classification E-value
Superfamily FF domain 0.00863
Family FF domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_035_00079.2|PACid:22061213
Sequence length 977
Sequence
MSSPAWSPRDTHSTTGITQQVSVSGPTATLISQTSAPSASCVDSQTLKSPSKNASVSFQE
YCLANHSATHHHIAPPPSFSYGAVPKPISTSEISQEASSTPVMKSSPTASNAVIQPPGPG
KSPGTGPSFSYNIVINNNVGSSAGQQFQSNTNASTAALREGGTCIVSSSGSQSLSVAAHS
SLSSSSTAATPNLYPTTMWMPTPSFTAHPGMGGSPATPGPPGIHLSGPFCSNNTVRSMSP
VMPFTATLPPNSVAQQIYPTFQSLPAMAPPPQAHWLQPPQIAGIQRPQYLQYPAMITNPF
PLPVRGQPHPSFSLPDSQPPGISPLGPSGGTSLDSMGSVQHVRSSGMQSELPPPGTDYEK
KADDNGGHITVSNEEAEAWTAHKTDTGAVYYYNAVTGESTYEQPHGYKGEPDKVTVQSTP
VSWDKLGTTDWALVTTDDGKKYYYNNKTKVSSWQVPVEVTEWMKKRHEGDPLRANTMSMQ
NSSMLPEKGPVSISLNTPAINNGGRDATALRPSALPGSSSALDMIKKKLQDPGMPIASSP
LPASSGPSTSDANGLRVVDATVKGPQDEDSKDKQKDANGGGNFSDSSSDSEDVDSGPTKE
ECIIKFKEMLKERRVAPFSKWEKELPKILFDPRFKAIPSHSARRSLFEHYVRTRAEEERK
EKRAAQKAAVEGFRKLLEEASEDIDHKTDYQSFKEKWGSDPRFEALDRKEREVLLNERVL
ALRRAVEEKLQATRAAASSSFKSMLRDKSDITSNTRWSRVKDSLRSDPRYKSVRHEDREL
LFNEYISELRAAEEEVYRATKAKREGQDKLKEREREMRKRKEREEEEVERASWTESKPKL
EKDPQERALNPALEKSDLEKLFREHVKTLYERCARDFQALLAEVISTEAATQATEDGKSY
LTSWSTAKRILKTDPRYSKMPRKDRESLWWRYAEEIQRKRKLASDPTDDRLNTEKGCRNS
LESVRSPAESRRIRERR
Download sequence
Identical sequences A0A2G5CW24
Aquca_035_00079.2|PACid:22061213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]