SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_035_00160.1|PACid:22061308 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_035_00160.1|PACid:22061308
Domain Number 1 Region: 256-361
Classification Level Classification E-value
Superfamily PH domain-like 0.0000616
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_035_00160.1|PACid:22061308
Sequence length 374
Sequence
MENGGYMSWKQSLEHVEEDQMMDIISPSLSEIPPPQTPHEPMEFLSRSWSISAAEISKAL
AQNQKQFANNKHSINSLQEVAASPPYLCKPVDMVSHKRGGSVGKWFHNKEISSSNYRIRK
KERARVDNARVHATLSVAGVAAALAAVTATENSNNSKMSAAMASATELLASHCIAIAESS
GADHDRVASVVRSAVGVRTPGDLMTLTAAAATALRGAAALKARLPKEVRNNAAVIPFEKD
LGTTCHCEKEIKESPCKGDLLHLSRKGILHWKRVSVYINKSSQVIIKYKSTHVGGTFSKK
KKCVVYSFCDGIFTWQMSDNIEQSCYFALRTAQGILEFKCQNKIHRQTWVDNIAHMLRKV
GNVERMNSSFSSNY
Download sequence
Identical sequences A0A2G5CWG0
Aquca_035_00160.1|PACid:22061308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]