SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_035_00189.1|PACid:22061260 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_035_00189.1|PACid:22061260
Domain Number - Region: 74-203
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0032
Family WD40-repeat 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_035_00189.1|PACid:22061260
Sequence length 237
Sequence
MSSVQTVFTIALMSNYLDIAAVSFFYTFNKNPYLCAKKYHPIYSDTYMMNIPHELGGAYV
RHAEYEWLLMSQGTKGGTSIFFFNPSTMETIRLPGGDLSCALENMSFSSPPTSSDYVVIG
HLMSATDAVLIYVYRKCEDAWKLPSPSVFQPSHCSPVFHDGIFYSLAKDGKLGVFNPNET
NEENMWRLLPNALAKEVSSPQWLSVIMRFFLRSYIMEYDGEILSVFLWSSGNSIVDV
Download sequence
Identical sequences A0A2G5CXL4
Aquca_035_00189.1|PACid:22061260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]