SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_037_00062.2|PACid:22040659 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_037_00062.2|PACid:22040659
Domain Number 1 Region: 761-1069
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.71e-51
Family WD40-repeat 0.00034
Further Details:      
 
Domain Number 2 Region: 283-331,458-554
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000108
Family Protein kinases, catalytic subunit 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_037_00062.2|PACid:22040659
Sequence length 1074
Sequence
MKPIYSNSTSRSSVNEFYFDGMEGREHIVSKDGKRVFVKVKDSNSRLTLHSYKIMEPSSL
AMSTSTLPAENTLNVSINKLDGEFVKECVSYPPGSTLPCTHSCSTNDAGFMVEDKLKLKE
YEKSKLSVVGGNGQWQNLYSLVGGFGNGNLHGNNMSKDKGVIIVGGEGNEGKKFLPDFRM
QKIPISRQPNQSRVSHKEIAVKPSTASGFSQFLVKNAMMEKESEYKNSEPCERFGSTFME
KNNGKETLTSSSSLNYKTKSDHLSLQNVGPCPITPTTSPKAINLREWLKPGFRIVNKAES
MHIFTQIVKLVDMAHSQKVALQDIRPSCFELLPSNKIKYVAPMARRKLVKSVTSQGIPFS
EHHMGRKRNLEQDGSSYSNLRTKHVKFGDKTNFDLQHAQSLSTSDIKCSTFKAGDITSVR
KQDSGSSFRDEAYSNLKLRVRNKSGSPSTPDSSKQRLTYIDSQLEDKWYTSPEELSECGS
TFFSNIHSLGVLLFELLCCCDSLEVHAASMADLRNRILPPTFLSENPNETGLCLWLLHPE
PSSRPTTREVLQSVLTRESQEQSSRNQQSSPCDNDDAESESESELLLYFLAALKNEKQNK
AFELAEDIGCLEADLKEVAKRHLSRMGGSLVSSHNKSSSAREVGFVHNDHPGLPRFRLGS
LPNKNESGLARNIGQLETAYFSMRSQVQLQDTDTVSRSDIDLIENRDILFSTGYENEERV
LEKKPTDRLGAVFDGLCKYARYSKFEQRAVLRNGDLLNSANVICSLSFDRDEDYFAAAGV
SKKIKIFEFDKLFNDTVDIHYPVIEMIGTSKFSCVCWNNYIKNYLVSSNYDGNVQLWDAS
TGQVFSQYMEHTNRVWSVDFSQVDPMKLASGSDDGLVKLWSINEQKSISTIRNIANICCV
QFSPHSTNLLAFGTADYKIYGYDLRNTRVPWCTIDGHRKAVSYVKFLDSATLVSASTDNT
LKLWDLNKTSCTGLSSSACSLTLCGHTNEKNFVGLSVSGGYIACGSETNEVFAYHRSLPM
PITSSKFGSIDPITGQETYDDYGQFVSSVCWKGESNMVVTANSTGSIKVLQLVE
Download sequence
Identical sequences A0A2G5CTJ5
Aquca_037_00062.1|PACid:22040660 Aquca_037_00062.2|PACid:22040659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]