SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_037_00081.1|PACid:22040388 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_037_00081.1|PACid:22040388
Domain Number - Region: 832-934
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000314
Family Myosin rod fragments 0.0019
Further Details:      
 
Domain Number - Region: 267-358
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00251
Family Myosin rod fragments 0.016
Further Details:      
 
Domain Number - Region: 1087-1196
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0392
Family Myosin rod fragments 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_037_00081.1|PACid:22040388
Sequence length 1267
Sequence
MTKHWWTESMKSFLGHHVTNENSEELEKNRKEIEKKINKMLKLVKEEEYTDGDLLENSSK
ETELINLVEDFQKQYQSLYALYDNLTGELKKETHQREKKKNHSSSSSSSDSDTDHSKSKT
RNREHELSKLTANLKLELEAANQKLATTSTEKEDLSLKYLEDLSKIDEAEKNVEHLKLMA
EQLEVERLRLQVENENMNIKLEAASKLEATLEQNLKNTDTENEALKIENSKALNKIEEGE
KVIEELRATIDQLKDEKLQLSVGNGALKLEVESVKQEVSDLKQQLDSAVHQVSTLNQALE
SKEEENGTMLSRNSDMTNEMEQAQKVIQELGDEIKQLKGMLEEREKEVSSLSKMRDDFVN
ESSARTKVLEAQVTDLQVKLDIVSTQKHEVDENLEQKTNEVQQKGEQNLILQQVQTDLQD
RVAELERLLTEQESQLTKLLTESGERKNSALAEIRDLKERGNDLQLEVESLRAQKYELEE
KMRNSLDEAKRLKEENLGIQLVVVELQSKISELEGMLGQSKDELFEVLKKLEDSENQATS
QIKDLTAQVNNLQLELESVLILKNGLELDIQKRNQEVSECQSQIEILNQDLSNKIADQQR
VLQDNDELAAQVKSLQLDLDNSITKKSELEVHVKTRSEEVEKFKEESLGVQLIKTELLEK
ISSMERSFHERGDELSSLHKKLEVTESQASAQMQELTVQMDNLKLELSSVCTQKNQLELE
MVKINQEASDYQMQIEKLNCELARMIEDQQGVLKEREDLITQVKSLQLEIGSLSTQRSDL
EEMIKGEAQKAERVGEESLALQLIIKELQDQNSDLERVSKEKEDEVSSLSKKLENSETDA
ATEINNYTATVNDLQLELATLHAQKNDLEMQIEKQNQEASENQTRLKELNIELTSKIVEY
ERRLKEQEDRFNDINEDYKQLEDSLQISRKDLQLAEMKISEMTEEFQMEIKSKDEVILKL
QEEVEELKKVIESGHEELEKLRVELCKLDETHRGLQEKLQLSETERTVTTKEKDNLLQTK
ERTIMMLTQMQEEHQEEIGRLQEEVDTIEVKLRLAVQKLRVTEQLLAEKEEHYGQMEENL
RHERKILEDEILRLSKQIASMKANMAKAFKAFSELELTFQKFEQYQGSFEDRISKFPHEL
QLAKNWISRTNGEKQELEKQAGDLVEELSDKKEQESVLQERIRNLAVKVGKEQEEKERVL
KIVSELGKKIEVLEKNMIQKEADLIGREEEKREAIRQLCLWIDYQHSYCDDLKQMIVKMS
KRSQRRT
Download sequence
Identical sequences A0A2G5CTH7
Aquca_037_00081.1|PACid:22040388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]