SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_037_00199.3|PACid:22040701 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_037_00199.3|PACid:22040701
Domain Number 1 Region: 274-524
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.79e-62
Family Extended AAA-ATPase domain 0.000000421
Further Details:      
 
Domain Number 2 Region: 542-750
Classification Level Classification E-value
Superfamily FtsH protease domain-like 1.22e-23
Family FtsH protease domain-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_037_00199.3|PACid:22040701
Sequence length 790
Sequence
MKTSDIFLSPRVLNPHFNINHDVSKVSSISLKTHSINNKLNNRNTPLFFNRSFKVFCNLN
SNSVSEDDFITRVLKQNPSQVEPKYLIGEKLVTLKQKQSINKGFNFKSFRLPKRFLEKLD
DEKEKGSLDPVYLKDLLREFKGKLYIPEEVFKVNLSEQEEFDRIFEELPKMSYEDFQKVL
KNDKVDLLTSKAVSGIPSEYGYRDFIVDLKEIPGDKSLQRTKWAMKLNETQAQTILEQYT
GQQYVIASHTTDIWQGIQFGQSKAQARVDGSTGVGFGDVAGIEEAVDELQELVKYLKNPE
LFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRD
LFKRAKVNKPSVIFIDEIDALATRRQGMFGESTNYLYNAATQERETTLNQLLIELDGFDT
GKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPGAKGRLDILKVHARKVKMSPTVDLS
TYAQNLPGWTGAKLAQLLQEAALVAVRRGHGSILQSDVDDAVDRLTVGPKCVGIKLGHQG
QCRRATTEVGTAMISHLLKRCENANLEFCQRISINPRGQTLSQSVYHRLDDECYTFERRP
QLLHRLQVLLGGRAAEEVIYGRETSRASVSRLADASWLARKILTIWNLEKPMTIHGESAP
WRKKARFVGPRLDFEGSLYRDYGLKEPPINLNMDDEVAQRTEDLIRDMYARTFSLLKRHH
AALLKTVKVLVDKKEISGQQIEYILDQYPAETPIRLLLEEENPGSLPFFEAEQRGDLELA
LLTPSNGDIH
Download sequence
Identical sequences A0A2G5CU10
Aquca_037_00199.3|PACid:22040701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]