SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_037_00277.3|PACid:22040558 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_037_00277.3|PACid:22040558
Domain Number 1 Region: 412-568,687-741
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000156
Family WD40-repeat 0.018
Further Details:      
 
Weak hits

Sequence:  Aquca_037_00277.3|PACid:22040558
Domain Number - Region: 1179-1326,1390-1464
Classification Level Classification E-value
Superfamily ARM repeat 0.0095
Family Clathrin heavy chain proximal leg segment 0.029
Further Details:      
 
Domain Number - Region: 1699-1751
Classification Level Classification E-value
Superfamily RING/U-box 0.0232
Family RING finger domain, C3HC4 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_037_00277.3|PACid:22040558
Sequence length 1902
Sequence
EILNDSDSSSSSSSSSSPSFNLKDIQHKSYSDKSPNSLSKDEEIEKSSVSSPQTPVETLK
PEEKKVVESIISSFRSRKPGEFSRNSYSLGRSTTSRPLPTLYGGVRVNPKPGAALAAAAA
ASRSIPTPHAAAIKSRRATSEAALLNVVNSELDFVDGTEAVDTSDNVSVNVESETIKLDS
RIGDSDGNAEDSPIILAEHISGREDVAEISHENTEASSFEEACQTQEEATKVDEIELGTN
YNSNVDEGSTVLSSTDVVENEKQLIDASENADESNLSSTCTAASDENHIPPENEVNSKVE
ESSVLMASEIPDAEKSHRENGLALDDTDVVEDRVVQLNSKRGGKKSGKKLRSFMKPLDLA
EELEKKHAYSGLHWEEGAAAQPMRLEGIRRGPPAVGYLQIDANNAITRTISHQVFRRDHG
SPQVLAVHPNFIAVGMSKGFILVVPSRYSSQNADSMDAKMSVLAPQGDKSHSPVTSMCFN
PQGDLLLAGYGNGNIIVWDVQRSTTAKVITGEHTAPVVHTLFLGQEFQVTRHFKAVTGDC
KGLVLLHTFTGVPLLRFSIKTQCLLDGQKTGIVLSASPLLIEDCGSSTAAPGNATASSSG
IGSMMGGVVGSSLFNERSSLVEEGVVIFVTHQTALVARLSPNLEVYARLSKPDGVRDGSM
PYTAWKCMTLSQGSTENLEGETLEKASLVIAWDRKVQVGKLVKSELKIYTEWTLDSAAIG
VAWLDDQMLVILTLRRQICLFSKDGNELHRTSFPADGLGADDFIVYHTYLSNLFGNPEKS
YHNCLAVRGATIYVLGPTHLVASRLLPWRERIQVLRTAGDWMGALDMAMRLYDGHAHGVI
DLPRTLDAIREAIMPYLVDLILSYVDEVFSYISVASCNQIEREAQYARVGGVAVEFCVHI
KRIDILFDEIFSRFVAVQHGGTFLELLEPYILKDMLGCLPPEIMQALVEHYSSKGWLQRV
EQCVLHMDISSLDFNQVVRLCREHGLYGALIYLFNKGLDDYKAPLEELLLILQSSERDIA
ASIGYRMLVYLKYCFSGLSFPPGHGILPHTRLPLLRKELLEFLLEDSNEMNSKLVASFKS
QIGVFPNLFHLLRLDTEATLDVLKFAFPEEEANFNHGLLDANKEDNEENNDNNTEGLNSM
VQSTVNTLIHILDIDISDEEVSSGASDMEFIEIWPSKKDTGHLLEFIAYFVARKRATIAK
TVLNRILEFLTSESIFSLPSQNIDTCKRREKQMLTLLRVVPEADWNSSYVLPLCEKAHYY
QVCGYIYTTKRQYDAALDSYMKDLNEPIYAFSFINTMLLHLKDTESVNFRFAVVSKIPEL
FNLSREGTFLLILDHFKEESEHILSELRSHPKSLFLYLKATIEVHLSGTLNFSSLEKGYI
PNLQTGSKPKNQLNEVELYLERISNFPMLVRDNPFHINDEVIELYLELLCQYERNSVLKF
LETFENYRVERCLRLCQEYRVIDAAAFLLERVGDVGSALLLTLSALNENFHKLGSAVENI
VSDSSSRSYSEKQLLEVVLRIEEVNAVRDILHSSIGLCQRNSQRLDPEESEFLWFQLLDS
FCEPLRDPSDAKIVSRGNLSPLTATFDVNEEKEQSVDKWRIPKSHGGVPILRKLFAQFIK
EIVEGMIGGYVRLPTIMSKLLSDNGSQVFGDFKLIILGMLGTYGFEKRILDTAKSLIEDD
TFYTMSLLKRGASHGYAPQNLLCHICGCPLTKESSISGIRVFNCGHTTHLRCEFQDHGSS
NGFRDGCSVCVPKKKTRGSRSESVLIENPLVKNFVSRSQQTQGANAVQHLHESDLVEKPY
GTQQIPRFEILSNLKKSQRSLQIETLPQLRLSPPAVYHEKIQKGTNVLGGESGSASVKGE
NSSRQLKELKLKKSSLRFPIKSSIFGNEMTRKLRLKTSGDLA
Download sequence
Identical sequences A0A2G5CUE7
Aquca_037_00277.3|PACid:22040558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]