SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_037_00291.1|PACid:22040322 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_037_00291.1|PACid:22040322
Domain Number 1 Region: 122-217
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-29
Family B3 DNA binding domain 0.0000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_037_00291.1|PACid:22040322
Sequence length 425
Sequence
MEFFQERGRCSEDEEVDMIGDMDKVPYSSSSSSSSQYNKGTTSSSTPQLNGGWGAQIYDK
TYHTIWSPEQEAAARCNYEQQHQKNIELNNNHKRGESDGGGGGGGGGGSGSGGEDVVCIE
REHMFDKVVTPSDVGKLNRLVIPKQHAEKYFPLDSTANEKGLLLNFEDRCGKSWRFRYSY
WNSSQSYVMTKGWSRFVKEKKLYAGDIVSFERGAGESVKDRLYIDWRRRSDVQDPGMLPP
LPLLHPLSMPRSAPWGGLMLPPNMPMHMPRDDMVWQRMNYAQNHNHFQRTNYSGISANGY
NVVNSGSSPIFYLRSSAPSQQIGVIQQGRDAPTVFNSVPVVHGKASAKRFRLFGVNLECP
MPENPEYQFLDSATINHPTIGSLAPSQIPPSIPPLQLRLYNSESPPREQSDSPRENASMS
LDLDM
Download sequence
Identical sequences A0A2G5CUH1
Aquca_037_00291.1|PACid:22040322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]