SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_037_00311.2|PACid:22040726 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_037_00311.2|PACid:22040726
Domain Number - Region: 265-325
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00275
Family Ribosomal proteins L24p and L21e 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_037_00311.2|PACid:22040726
Sequence length 528
Sequence
MEPPSSSSSSSSKLSFSLPSTNKRPSSLSSNSNFPFEETNSSSQQHEFVTEFDPSKTLTT
HQSTTHVIPRLENTWNPYKKMKNLDIPFRSASDDPDLRFELEAPNTIATDSSMAYGLNIR
SNGGGGAGADDKLKNSLSSGAGAADKLQQQQQQRSVENVILQKYKEDMKILPDDRGLEEF
DDVPVEGFGIALLKSYGWSEGKGIGKNAKEDVKVVQYVRRADKEGLGFQSSSIDEKKPGQ
KQHLVAPRGPDGKTRHVVGIDEKLVPRELKGIHVGKIVRVVSGRHIGLKGKVLEKYDSHS
SSSVMVVLKLIRSDEEVTVGLKEVAELGSVDEELCLEDLKMKDNLRRMERRGSLSHREEK
KMNGNRYDKETVKRRNRDEGGSVKQEKYGSNTKHCDNKEKEKKTLPVSWLASHIRVRIIS
KDLKGGKLYLKKGEVLDVVGPGTCDISLDESKELIQGVNQDILETAVPKPGGPVLILYGK
HKGTFGYLVERNMEKETGVVQDADSHALLNVRLEQIAEYIGDPSCIGY
Download sequence
Identical sequences A0A2G5CVQ2
Aquca_037_00311.1|PACid:22040727 Aquca_037_00311.2|PACid:22040726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]