SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_037_00324.2|PACid:22040686 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_037_00324.2|PACid:22040686
Domain Number 1 Region: 431-635
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.87e-37
Family ABC transporter ATPase domain-like 0.00018
Further Details:      
 
Domain Number 2 Region: 159-327
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00000000196
Family DNA repair protein MutS, domain III 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_037_00324.2|PACid:22040686
Sequence length 666
Sequence
LSTTLKLTTSSSVLYYSSNVSSSSSSSQKSSVVAETSLRILEWDKICDCVASFAGTFLGQ
QAIKQQLWKLNKTYDESNTLLAQTSAAVQMLNYGSSALDFTAIDVLLVRSAIQHASRGLP
VEGKQAMAVVYLLLFSQTLQSNVKAACKQDSDWYNRFMPLTKMVMELVTYQPLVKSIRQV
IDDDGSVKDSASSKLKQFRDQVRTLEGKLFQLMDSLVRKESDKTSSLEVSTIDGRWCIKS
WSDQLTTVSGLLLSSGSGVGCLMEPLSAVPLNDELQQARASVAMAEKDVLLRLTEKMRAD
LDGIHDLLDTIIQLDVITARAKYSLSFGGSFPDLLLTEDKDAHIGDEYDASGKRTLNDDL
STFNKRKWILYLPKAYHPILLQQHQQNLEKARENLKKAIADIQRRKLQPENVMLEGKAGV
NIESLEMEVTKLEQARPVPVDFFIGTKTKVLIITGPNTGGKTISLKTLGLAAMMAKSGLY
VLSSEPVRIPWFDSIFTDIGDEQSLSQSLSTFSGHLRRISAIRAHSTSQSLVLLDEVGAG
TNPLEGAALGMSLLESFSDAGALLTIATTHHGELKTLKYSNDTIENACMEFDEVNLRPTY
KILWGIPGRSNAINISERLGLPDIVVNNARELYGTASAEINEVIMEMERCKQEYQEHVHE
AHHYLA
Download sequence
Identical sequences A0A2G5CVR7
Aquca_037_00324.2|PACid:22040686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]