SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_037_00342.3|PACid:22040154 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_037_00342.3|PACid:22040154
Domain Number 1 Region: 235-427,631-712
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.07e-53
Family Diacylglycerol kinase-like 0.0035
Further Details:      
 
Weak hits

Sequence:  Aquca_037_00342.3|PACid:22040154
Domain Number - Region: 125-194
Classification Level Classification E-value
Superfamily PH domain-like 0.00295
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_037_00342.3|PACid:22040154
Sequence length 715
Sequence
MHKTGNLPQNISSLRVMPQQSLRRLGSRCSQIATGQHSSPTVFPEKRGKVKSSRPTEANV
ASGEPGKADTQDHRIDIGDENSDLLGYEVLCGKLALDKRTTSNTPDLQTSTQSTTQDAAD
AKLTSKALVWGSHMLYLDDVISVSYNVGLRHFTVHSYPIRKGSCLSCFMNPRRNRKDLRF
LASSPEEALHWVSGFADQQCYVNCLPHPLVSSKKQASDIVASDFPPEQLIKCKTPPKMLV
ILNPRSGRGRSSKVFHGKVEPIFKLAGFKLEVVKTTSAGHAKKLASSVDFSTCPDGIICV
GGDGIVNEVLNGLLSRNDQKEAISIPIGIIPAGSDNSLVWTVLGVRDPVSAAIAIVKGGL
TTTDVFAVEWIQTGFIHFGMTVSYFGFVSDVLELSEKYQKRFGPLRYFVAGFLKFLCLPK
YTFEVEYLPASKNASDPDGNVSGDRETLDIQDLYTDIMRRSNTDGIPRASSLSSIDSIMT
PSRMSGDLDTTSSTHASTEPSEYVRALDSKSKRLSSSRSNVMAEPEEVLHPQLPMSTTPN
WPRTRSKSRTDKTWTGLTATQDSTRCSWGNAATNDKEDISSTMSDPGPIWDAEPKWDTEA
NWDVDNHIELPGPADDVEGAKKEVSPKYDEKWVVTKGPFLGVLVCNHSCRTVQSLSSQVV
APKAEHDDNALDLLLVHGSGRIRLLRFFLRLQFGRHLSLPYVEYIKVSNGTIYYS
Download sequence
Identical sequences A0A2G5CUT3
Aquca_037_00342.3|PACid:22040154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]