SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_038_00055.1|PACid:22026856 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_038_00055.1|PACid:22026856
Domain Number 1 Region: 98-135
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000392
Family B3 DNA binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_038_00055.1|PACid:22026856
Sequence length 158
Sequence
MMIKSKKEKENEGINEGQMTLAQCFQSLQSSSEPLTPLSMVVLNKPETPSRSVPSFQQVV
LDKPAEAPLSYEQEQAFPNHDKVKLCAIQRAEEVQANLDPRFPSFVKSMLHSHVIKGFWM
RIPGQFCKTTFQNMMLQLLWLMRIGKNLLLITSCIRLD
Download sequence
Identical sequences A0A2G5CSD9
Aquca_038_00055.1|PACid:22026856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]