SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_038_00098.1|PACid:22026615 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_038_00098.1|PACid:22026615
Domain Number 1 Region: 17-127,580-731
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.16e-22
Family WD40-repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 17-318
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000208
Family WD40-repeat 0.016
Further Details:      
 
Domain Number 3 Region: 1001-1113,1223-1319
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000922
Family PBS lyase HEAT-like repeat 0.072
Further Details:      
 
Domain Number 4 Region: 1337-1431
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00000863
Family Quinohemoprotein amine dehydrogenase B chain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_038_00098.1|PACid:22026615
Sequence length 1523
Sequence
MKCEAIACIWSGAPPLHEITATAVLNEPPTLYTGGSDGSIIWWNLSTSYSNQSNKEIWPM
AMLCGHATTIADLDICVPTTVDAQEEKEISSNVVMNSTSSGYGALISASTDGMLCIWSRN
SGHCLRRRNLPPWVGSPSSVSTLTTSPRYVCIACSSVDTAHSSSQQTMEHVETGESMVDR
EFQHRSAWTKYAVVIVDSYSLNIVRTVFHGGLSIGQLKFMAVVPSGKYMEVSSVVLADVY
GKMQSIILLEESDQDRDGKTNMVRSSSHSMMSILSDVSSDGDQVVSISAHGRLLVLVYRS
RCIFCLVDNGIAVGEISLSDGPLCDDGLPLQSHVIGGMFLVWDKDGKVLDTEEQQKEFTE
SFLIWNNKGAALVYQISGSDHTFNFELSCEIPAVTHDLDVKLTIRFCHINSFILRIESTC
FIVEESLFWKPHITVWSLSDQNDPHRKLDLQGTMLGEGGILGEWTKSSRLFSMNGSCKYN
ANVISISGEIQEASHENGGPILTVANGCYGEGKNNSLVLKENTVSSSMVLFERFCAPYAI
VYGFFSGRIEVVHFDISFQELNSSGSPHHEVKPHVSKQYFSGHTGPILCLAAHQLVGAPS
ARSFSKILVSGSMDCTIRLWDLDTSDLITVMHHHVAPVRQIILPPAWTDRPWNDCFLSVG
EDCCVALASFETLRVERIFAGHPIYPSLVVWDGARGYIACLCKNNSGISDAVDVLCLWDV
KTGSRERVLRGPAAHSMFDHFCEGINLNFVTDNVLGGITSASSLLLPINADMSSQSHSKH
LEMGVSSSNTSQRTIIDLTQSTIAHANEGKSARHLPSAKVHQNNMHPVKCSCPFPGIATL
RFDLPSLMFPCQNHSQIFENRGKIENELLSHKGPQTPSSFIPTSNDISDTQENEKGPMEE
HEWLKFVEGCILRLSLSFLHLWGVDHELDGLLISEMEVNRPQNFIVASGLQGDRGSMTLT
FPGPRATLELWRSSSEYCAIRSLTMVALAQRMVSLSLSSSAASSSLAAFYTRHFSEQVPD
LKPPSLQILVSFWQDESEHVRMAARSLFHCAASRAIPHPLCGQKLDQITSLPLSSGDLND
EQKPISTRETSASSSMEPFMTTEIQDDSQSEDSSILTWLESFEMRDWISCVGGTSQDAMA
SHIIVAAALAIWYPSLVKLKLAALVVHPLIKLVMAMNEKYSSAAAELLAEGMESIWKACI
GPEIPRLLGDIFFQVECVSGASANSATQNAVAAMTIREVLVGILLPSLAMADIPGFLHVI
ESQIWSTASDSPVHLVSLMTLIRVVRGSPKPLAQYLDKVINFILQTIDHGNSVMRKTCLV
SSMAALKEVIRAFPMVSVNDSSTRLAVGDPIGKIESVTIRVYDMQSVTKVKVLDASGPPG
LPSLLGGSSEMTVTTAISALCFSPDGEGLVAFNDHGSMIRWWSLGSAWWEKISRNLVPVQ
CTKLIFVPPWEGSSPNYSRASIMETITGHDRQVDSEGKSKGSSDVSSPRLLIYNLDLSYH
LAWVGERKVLLTRHGHELGTFQL
Download sequence
Identical sequences A0A2G5CSM9
Aquca_038_00098.1|PACid:22026615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]