SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_038_00104.1|PACid:22026650 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_038_00104.1|PACid:22026650
Domain Number 1 Region: 218-482,641-656
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 4.32e-19
Family DPP6 N-terminal domain-like 0.021
Further Details:      
 
Weak hits

Sequence:  Aquca_038_00104.1|PACid:22026650
Domain Number - Region: 18-157,190-245
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000415
Family WD40-repeat 0.06
Further Details:      
 
Domain Number - Region: 438-649
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000604
Family WD40-repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_038_00104.1|PACid:22026650
Sequence length 1121
Sequence
MYMAYGWPQVIPLEPQLNSVSQRIVYLKVINRLLLVVTPSHIELWSSSQHKVRLGKYKRD
LDSIQREGENLQAVWSPDTKLIAVLTSSFFLYIYKVQFTEKKLQVGGKSSLFLATISLLL
SEQAPFADGNLTMSNIVCDSKHLLLGLSDGSLQLITWKGEFSGSFGIDRNLCGSNEITEQ
QHSLENGLASEGALRVFISNIALNISAILQLELSLPLRLLVVLFCDGKVALCSLSKKGLK
LTESVKAERWLNTGDAVCASVASDQQILAVGTRRGIVELYDLAESASLLRTVSLYDWGYS
TEDTGPVSCITWTPDTSAFAVGWKLRGLTLWSVSGCRLMSTIRQIGLSSVSSPMVKPNHD
FKCEPLIGGTSSMQWDEHGYKLYCIEEGSSERILSFSFGKCCLNRGVSGVTYVPQVIYGD
DRLLIVQSEDTDELKLVHVNLPVSYISQNWPVLHVVASKDGSYLAVSGLHGLILYDLRNK
KWRVFGDITQEQKIQCKGLLWLGKIVVVCNYIDSSDMYELLFYPRYHLDQSSLLCRKPLL
GKPMVMDAFEDYILVTYRPFDVHIFHVDILGELAPSSNPSLQLSTVRELSIMTAKSHPAA
MRFIPDQHMKEIVPKDHLSSSSNSSDIQPARCLILRTNGELSLLDLDDGRERELTDSVEL
FWVTCGQSEEKANLIEEVSWLDYGHRGMQVWYPSLGADPFKQEDFLQLDPELEFDREVYP
LGLLPSAGVVVGVSQRMSFSASTEFPCFEPSPQAQTILHCLLRHLLQRDKSEEALRLAHL
SAEKPHFSHCLEWLLFTVFDADTSRQSSNKNQSSVPKRTAPSLLEKTCDLIRNFSEYHDV
VVGVARKTDGRHWADLFLAAGRSTELFEECFQRRWYRTAACYILVIAKLEGPAVSQYCAL
RLLQATLDEALYELAGELVRFLLRSGREYDNPNTDSDKLSPRFLGYFLFRSSSKRQSFDN
KSASFKEQSAHVTSVKNILESHASYLMSGKELSKLVAFVKGTQFDLVEYLQRERNGSARL
ENFSSGLELIGQKLQMDTLQSRLDAEFLLSHMCSVKFKEWIVVLATLLRRSEVLFDLFRH
DMRLWKAYSMTLQSQPAFSEYGDLLEVLEEQLPSTRSLEER
Download sequence
Identical sequences A0A2G5CSN9
Aquca_038_00104.1|PACid:22026650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]