SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_038_00139.5|PACid:22026893 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_038_00139.5|PACid:22026893
Domain Number - Region: 478-500
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0188
Family N-utilization substance G protein NusG, C-terminal domain 0.054
Further Details:      
 
Domain Number - Region: 217-300
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0308
Family Ribosomal proteins L24p and L21e 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_038_00139.5|PACid:22026893
Sequence length 1501
Sequence
MALKGKEIVRETPPLKRKGDHSDKSGNSRKRTNPGVLQFFDVAADVDEDDDDDSDSDESS
EEDDFEKDFMEEVTTGQNEKSAFGKTHNVPFLPKEEELSADELEMLVKERYKPGSKYVTH
AYDQNKTAGSGEVDSLMSSVGDPIIWRVKCTVGRERRTVFCLIQKFVDLQSLGNKLKTAS
AFAPDHIKGYIYIEAEREFDVVEACKGLTTVYTSRISSVSKNEIAHLFAARNTGIDIPQG
TWVRVKHGNYRGDLAQVVKFDDIRKKATVKIIPRIDLQVLARKLAGEGTTKQAAIPVARV
ISSKDLEEFRPHIKLKRDRQTEKVFETICDLKLKDGYLYKKVSIESISYVDVVPSADELL
KFKPYKKDASDDAEWLSHLYGEQKKKRLSECSKGTAKGLEGTSETKKGNDFQLHDLVSFG
PKDFGVIIGVESDSFQILKYDEVQGAEVLSLELHEITGSSFDKKFTTMDHRMKATSIRDT
VRVLEGPFTGRQGVIKHICRGIIFIYDENQLETGGYFCAKSQSCEKISHSNDTNHESSSD
VFGTQGFEDIPASPKSPQSSKKPWQEKENAREFNGRREGDRDGAFSVGQSLRIRVGPLKG
HLCRVVAIYRSDVTVKVDSQMKILSVKREHLSEVGVRSNFMKQSDGLGRQGETSGAQTES
NGWNSIPPDTGRSSWPDCSSSDFLLHSSWKNPCDSLVTSDDPDKEKGDDPWGSRVTHKKT
TDSWGHAAGSGETLEKGKEEESDPWGNKQNSTKVTDSWGNAGAFVEDTGKDVGDDSWGSK
GTSTQAIDSWGNAIGIGGNSEKEGGDDPWCSMATTSKKSSDSWSNAVGFGEDAEKGKAVE
DDAWGSKGTSKKALDSSDDAICSGGDLEKGKDGGDDPWGGKATGSEQATDSWGNAVGFGG
NLEKGKDGGDDPWGGKATGSEQGTDSWGNAVGFGDDPGKDEGGDLWGSKQTQAKSTEGYR
NITDSDCWGKGKGIAENDNSGWGSAALVQNTDTWHKGKSEAGKECGVATGTQDKWSSQKV
AGGDRSFDWNEGSANEVGDTDNQHNSWNKPINFDGGRDSDGRRGRGGYRGGNRDRSGRGR
SFGSGGSSNWGSNTPDSDSWGKRKGIAENDNSGWGSAAMVQSTDTWGKGKSEAGNECRVA
TGTQDNWSSQKVAGGDRSFDWNKGSANEVGDTDNQHNSWNKPINFDGGRDSDGRRGRGGY
RGGNRDRSGRGRSFGSGGSSNWGSNTPDSDSWGKRKGIAENDNSGWGSAAMVQNTDTWGK
GKSEAGNECRVATGTQDNWSSQKVAGGDRSFDWNKGSANEVGSTDNQHNSWNQPRNFDGG
RGSGGRRGRGEFRGGNRGQSGRGRSFGRGGSSGWGSNTTDSDCSGKGKGITGNDNSGWGN
AAMVQNTDTWGKGKSEAGKECGVATGTQDSDCWGKGSSGWGTNTPDSDCSGKGKGITGNG
NSGWGSAAMVQNTDTWDKGKSEAGKECGVATGTQDSDCSGKGSSGWGSNTTDSDCWGKGK
V
Download sequence
Identical sequences A0A2G5CSX1
Aquca_038_00139.5|PACid:22026893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]