SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_039_00045.1|PACid:22062255 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_039_00045.1|PACid:22062255
Domain Number 1 Region: 469-755
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-78
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 69-197
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.96e-26
Family alpha-D-mannose-specific plant lectins 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_039_00045.1|PACid:22062255
Sequence length 800
Sequence
QYANISTKWTNNPSCLTKKYDDGSMVRFIIDAPVQTPHFSLAFYCNGNCTSFLLGVFLHY
HLHDAGDPQLIWSANRNNPVRENSTLEFTQDGDLILRDVNGTSVWSTNTTGRSVVRLEVT
EMGNLVLFDANNQIIWQSFDYPTDTLVLGQTLVAGQKLIASASATTWNEGLQYLSVTSDG
LFAFINSNPPLSYFEKNTSTKIGYMTFLNGSLSLYAKNPESDKPVMEILVPPVSSEFQYM
KLDSDGHLKVYAWVSKWDQVADIFSDSIVDNCRYPLACGKYGICLNNQCTCPEDTYFQPV
DERQPNLGCTEITPLCCEVPQNHQILSLDNISNFKVGNDSIYTDIESCKQACLKNCSCKV
SFFRRHGTNSKGECYMETEVFSLINNENHVKSNTTWSVHIKVVAITLGKSPESSRTGHPK
ANIVKGVLVLVSVLGTVFVVLIIIIKLALLKKNKKKKAIEKYENCHNLLPGTPMRFSYEE
LKTATKNFCRKLGEGASGSVYEGTLINGKKVAVKWLDGYKHAEISFVAEVETIGSIHHVN
LVKLIGFCTDKSHKLLVYEFMCNGSLDKCIFSGKNEIVLNWQTRRKIILDIAKGLAYLHE
DCRQRILHLDIKPQNILLDDKFNAKVSDFGLSKLIDKDQRKVMTAMRGTPGYMAPEWFSF
VITEKVDVYSFGIVLMEILCGKKNVDFSKPDESMHLLSLLEKNAEEDRLCDMIDSNCDDM
KLHTEDVMKMMNLVVWCVQSDFCKRPSMSVVVKVLDGLMDIESNLDYKFVNNLPFVPIVC
DKVGVIVSSPLLPSVLSCPR
Download sequence
Identical sequences A0A2G5CRW0
Aquca_039_00045.1|PACid:22062255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]