SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_039_00047.1|PACid:22062300 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_039_00047.1|PACid:22062300
Domain Number 1 Region: 453-739
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.93e-80
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 53-177
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.13e-22
Family alpha-D-mannose-specific plant lectins 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_039_00047.1|PACid:22062300
Sequence length 784
Sequence
GFNDGSLVRYISTQPSYDEYDPSFGLGFYCTGVCTSFLLAIFSHCPRFQMGFPQVVWSAN
RNNPVGENAYLILNQDGLLLRDANGKDVWSTHTSGKSILGLKLTDMGNLVLFDKSNRTVW
ESYNHPTDSLVLGQKLVHGKKLIGSTSPLNSTEGLLSLTVESDGLFAFVESNPPLSYSEF
PVAGMKKSKEPSYVRFLNGSLAFYILNAEPNPPDYSLEILLALSIQIMRLESDGHLRVYM
WNSMWLQVADLLSYYSKDDCNYPTVCGNYGICSRENCTCPESHFRPVSDSHPNFGCYATT
PLSCKHLQYHHLIVLNHVSYFHATNKIGNIDIQSCKQKCLTICSCKAVFFMYVDGHTKGD
CFIQLSTIFSLIKVSRGAFYDWNAFLKVQTVPNAFSPSNEPSPTVISPIKRNYGLKVVVV
VILVGVILSLTLISCVLLRKKYVYGNDERYLDQIPGMPSRFSYKYLKVSTDNFSRKLGEG
GFGTVYLGALANGTKIAVKRLNELSDTKSSFLPEVESICSIHHVNLVRLIGFCAHKSHTH
LVYEYMCNGSLDKWIFGNGRDTSLDWKIRKKIILGVAKGLAYLHEECRLRILHLDIKPQN
ILLDSDFNAKVSDFGLCKLIDKDQSKVMTTMRGTPGYLAPEWLNSVITEKVDVYSFGVVV
IEILCGRRNLDLSQPEESRHLLSLLEKNTQGNFHDMLDSHCVDMQLHEEEVEEMMKVAVW
CLQGDFSKRPSMSVVVKVIEGVIEIESELNYSFLTTLPLSTKIVQNAALVSSPLFSSILS
GPRT
Download sequence
Identical sequences A0A2G5CRL5
Aquca_039_00047.1|PACid:22062300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]