SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_039_00052.1|PACid:22062180 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_039_00052.1|PACid:22062180
Domain Number 1 Region: 501-790
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.5e-77
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 87-183,263-278
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.7e-23
Family alpha-D-mannose-specific plant lectins 0.0027
Further Details:      
 
Weak hits

Sequence:  Aquca_039_00052.1|PACid:22062180
Domain Number - Region: 371-408
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00628
Family Pan module (APPLE domain) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_039_00052.1|PACid:22062180
Sequence length 832
Sequence
MGLIVSELVILNLLLLSSFPFSVYSINEDFRSANNLSTVWTNNDSNLKSIFTFDSVLRLV
LYTYNNSANVPELGSGCGFYRNDKISNRYYFVIVFFTTNLKGWMYSPQVLWTANRNNSVS
DNATLELTSMGDLVLKDVDGSLVWSTNTSGLSIVGMKIGQTGNLILHNAENTIIWQSFDH
PTDTWISGQHLTVGQRLVASVSTFNPSPGSLYMVLLNDSFSAFVDSNPPQMYVSYEYKKL
TTTTIETRKGTRDQILVFTSRYTAQYIRLDSDGHLRLYHYHYEREDLVEDIMSDELRDCA
YPTFCGNYGICSDGQCSCPKGSNRDPTYFQQLNVTQSSLGCNQTTPLSCTNPQYHVLLDL
EYVDYFSFIPVQSDIDIESCKQACLRNCSCKAAVFRYSHNTSHGNCSLANNIFSLMRNTG
KEDYDATTFIKVQDTSLAPHGKFPTDKSTNHLQRILVPTISVLSLLIVFGLCFVFFFFRK
KNVVGSVESAQADREHDSVDQVSGNPKRFSYDEIKSATGNFNKRLGGGGFGSVFGGSFDD
GTKIAVKCLEHLGQGRKEFLAEVKTIGSIHHVNLVRLLGFCAEHSRNILVYEHMCNGSLD
KWIFSRHQDFILDWSTRRNIILDIAKGLSYLHEECQKRIIHLDIKPQNILLDSKFNARIS
DFGLARFIDRDQSQVLTTLRGTRGYLAPEWLLNRRISEKVDVYSFGVVILEIMCGRKNLD
YSQDEENECLLHLVKKKAEEDHLVDIVDKQCDDMLEHSEEAVKIIKIAIWCLQGDCSKRP
SMSMVVKVLEGVMDMENISDYSFLTLTPMELPREVNASESAAPLPSILSGPR
Download sequence
Identical sequences A0A2G5CRR1
Aquca_039_00052.1|PACid:22062180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]