SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_039_00077.1|PACid:22062238 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_039_00077.1|PACid:22062238
Domain Number 1 Region: 494-784
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.11e-80
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 96-224
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.58e-23
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 
Weak hits

Sequence:  Aquca_039_00077.1|PACid:22062238
Domain Number - Region: 375-411
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0118
Family Pan module (APPLE domain) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_039_00077.1|PACid:22062238
Sequence length 822
Sequence
MALYFVFLHLTLLLYFSYPTNAQFFFGPVVNVSTTWINNPSSCLSRTSIDGSAVRIIFNR
RVSFYTFFGFGFYGGGNCTSYQLSVFVYNNDTILTFPSVIWSSNRNNLVRDNATLEFTQE
GDLILRDVDNSFVWSTNTTNRSIVGLTVTDLGNLVLFNANNSIVWKSSDYPTDTLVLGNK
LSEGQRLIASVSKSNSTEGLFSLFVNAKGLFAYVESNPPVSYFEYSVSEPKKRKDPSYMI
FMNGSVTLYILNDEQNDPDCTYLVPPASSIQFLKLDIDGHLRVFESEKGQVADIWQPFTD
VCAYPLACGNYGICSLGQCTCPQLISNGISFFKPIDDRQPNLGCYETTPLSCQAPQDHIL
LHLEDITYFHLIDGINSMTLERCKEICLGNCSCKAAFFRYLESETNGECFIQNDVFSLID
NAKNIDDYKQLVFIKVQMMTNGVHSPTKPSSNVLFQTHAIKVYIIIIAGLSITVTSYVIW
KKKRNVSDKSINYLDQLPGMPTRFSYKDLRVATKNFSNKLGEGGFGTVYEGTLTDGTKVA
VKRLYGLRNMKSSFLVEVETISSIHHVNLVRFLGYCVDASHQLLVYEYMCNGSLDNWIYS
RNQNPTLDWQTRKKIILDIAKGLTYLHEECEQKIVHLDIKPQNILLDNKFNAKVSDFGLS
KLIDREQSKVMTTMRGTLGYLAPEWLSSVITEKVDVFSFGIVVIEMLCGRKNLDFSQPEE
CIHLLSLLEKSAKEDQLQDMVDKICEDMELPREEAVKMMKVADWCLQNEYSERPSMSVVV
KILEGAMDIEVDLASKFSSALPASTTVVAWSPLLSSVLSGPR
Download sequence
Identical sequences A0A2G5CRQ3
Aquca_039_00077.1|PACid:22062238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]