SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_039_00079.1|PACid:22062104 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_039_00079.1|PACid:22062104
Domain Number 1 Region: 458-753
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-74
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 65-173
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000249
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 
Weak hits

Sequence:  Aquca_039_00079.1|PACid:22062104
Domain Number - Region: 198-252
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 0.0196
Family Nitrous oxide reductase, N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_039_00079.1|PACid:22062104
Sequence length 794
Sequence
MFRLHGSITPQVKFFGGGSLVRLIYSHPVNNQYTPYFTFAFYCNGNCNYFQLAILFNYTS
TRLELPEIIWSANRNKLVRENSTLKFNREGRSVTGLKFTDFGNLVLIDKNNSFVWQSYDH
PTNTLFLGQKLVEGQKLVASVSEFNWTEGLYSLSVTANGLFAFFASDPPLSYSETKISGP
KTSKEPSYAKFFNGSFALYILNAEPNKPDRVISVPASSFVQYVRLDTDGHLYVYDFVNIL
SVVDLLTTSYEGDCGYPLVCGNYGICSSHYEYCTCPPVTEDGVGYFRPVDEYDPYLGCYE
ITPLSCEDPQSHLLLDLHDITYFNLRNGTNRTDYDSCRLACLSDCSCKVAFFRHPKNEVE
GNCFIQSDVFSLVNYSDTKNSSRYNVHAFIKVQTPSSQPTGIIDDVPKAKDNVTPRSSTF
ILVASLAALLTLIIVIYVAVKKNNVIEEDEICLDHLQGIPSQFSYEDLKAATGNFRRKLG
QGAFGTVYEGVLTNGVKVAVKRQNGLGNMKTSFLTEVQIIGGIHHIKLVRLLGFCADKSH
RLLVYEIMGNGSLDKWIFGRKKDETLDWKTRKKIILDIAKGLTYLHDPIKIPGITHEECQ
NRILHLDITPQNILLDNKFNAKVADFGLSKLINREQSRVMTIMRGTPGYMAPEWLNSMIT
EKVDVFSFGVVVLEMLCGRKNLDFTQPEEYMQLLQLLEKMEKEDRLHDMIDKNCEDMQLH
CEEVVEMMKVAEWCLQSEYSERPSMSVVVKVLEGLMDIKLNLNHNISSALPLSTTTEGLA
ASTSLLPSILSGPR
Download sequence
Identical sequences A0A2G5CRR0
Aquca_039_00079.1|PACid:22062104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]