SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_039_00082.1|PACid:22062130 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_039_00082.1|PACid:22062130
Domain Number 1 Region: 521-806
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-79
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 101-228
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-25
Family alpha-D-mannose-specific plant lectins 0.0038
Further Details:      
 
Weak hits

Sequence:  Aquca_039_00082.1|PACid:22062130
Domain Number - Region: 253-309
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 0.000746
Family Nitrous oxide reductase, N-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_039_00082.1|PACid:22062130
Sequence length 847
Sequence
MSLSLYFPLLHLILLIFSSYSINAQSSGDTIANVSTSWINNPSSCTEVKFFGGGSLVRLI
YSHPVDNQYTPYFAFAFYCNGNCNYFQLAILFNYTSTRLELPEIIWSANRNKLVRENSTL
EFTREGDLILKDVNGSFVWSTNTSGRSVTGLKFTDFGNLVLIDKNNSFVWQSYDHPTNTL
FLGQKLVEGQKLVASVSEFNWTEGLYSLSVTANGLFAFFASDPPLSYSETKISGPKTSKE
PSYAKFLNGSFALYILNAEPNKPDRVISVPASSSVQYVRLDPDGHLYVYDFGDILSVHNL
LTTSYGGDCGYPLVCGNYSICSPHYEYCTCPPVTEDGVGYFRPVDNHNRRLVCYEITPLS
CEDPQSHLLLDLHDITFFNLGNGTNRTDYDSCRLACLSDCSCKVAFFRHPKNEVEGNCFI
QSDVFSLVNYSDTKNSSRYNVHAFIKVQTLLTGPEPSPSSQPIGITDDVPKAKDNVTPRS
STFILVASLAALLTLIIVTYVAVKKNNVIEEDEICLDDLQGIPSQFSYEDLKAATGNFRR
KLGQGAFGTVYEGVLTNGVKVAVKRLNGLGNMKTSFLTEVQIIGGIHHMNLVRLLGFCAD
KSHRLLVYEIMGNGSLDKWIFGRKKGETLDWKTRKKIILDIAKGLTYLHEDCQNRILHLD
IKPQNILLDNKFNAKVSDFGLSKLINREESRIMTIMRGTPGYMAPEWLNSMITEKVDVFS
FGVVVLEMLCGRKSLDFTQPEEYIQLLRLLEKKAKEDRFHDMIDKNCEDMQLHREEVVEM
MKVSEWCLQSEYSERPSMSVVVKVLEGLMDLKPNLNYNFSSTLPFSTTTEGLAVSPPLLP
SILSGPR
Download sequence
Identical sequences A0A2G5CRM1
Aquca_039_00082.1|PACid:22062130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]