SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_039_00136.2|PACid:22062226 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_039_00136.2|PACid:22062226
Domain Number - Region: 118-144,201-283
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00333
Family WD40-repeat 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_039_00136.2|PACid:22062226
Sequence length 350
Sequence
MKGLLLDVQIVYPVNILKLQVRGSKRIFRHDDSSSEEVCVVMPGVIARFEGSDVQSLLRR
WCQETRAHLWDENWRKREPEDPGNSYGRLPYQLWNISKYGSCLDAAITGIMPPPLLELQS
SERYYCAVSIGEDAVLSAYRLSENRNRSIVGAILSKVVPAAFSTISSFSRMIWRSEKPST
TKVEEKPQSFAKASSLTCLKDHPRKGENLTLSPGGTLAAITDSLGRILLLDTRALVVVRI
WKGYRNARCLFMEMLVGRDTVASSSSYHELSKSDYCLCLAIHAPRKGIVEVWQMRIGPRL
LAIQCAKGSKIMQPTPRFGSSTTQSSYVPLEVFLLNGDSGQISVINRSLN
Download sequence
Identical sequences A0A2G5CRV0
Aquca_039_00136.2|PACid:22062226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]