SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aquca_040_00089.1|PACid:22044475 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_040_00089.1|PACid:22044475
Domain Number 1 Region: 4-87
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 2.09e-33
Family Cytochrome b5 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_040_00089.1|PACid:22044475
Sequence length 132
Sequence
MPTLTKLYSLKEAGEHNTRDDCWVVVDGKVYDVSSYLDEHPGGDDVLLKATGKDATDEFN
DAGHSKDAIQLMEEFCIGELDPSDIIPEEESSADKEVDLTKRIMDMTSQYWVIPVGIVGI
SVVACLFYMRRK
Download sequence
Identical sequences A0A2G5CRC4
Aquca_040_00089.1|PACid:22044475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]