SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_041_00065.2|PACid:22029324 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_041_00065.2|PACid:22029324
Domain Number 1 Region: 54-285
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000144
Family WD40-repeat 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_041_00065.2|PACid:22029324
Sequence length 661
Sequence
MENRGGTLKSTSINGVKMYSVSGSRSVATWLPPKKQRELRKDKDYQQRMELIQDLRFETA
TTKIKATPDGEFLIASGIYPPQVKVYELRELSLKFERHLISEIIDFQVLSDDYSKLAFLC
ADRSVCLHAKYGSHYSLRIPRMGRDMAYDSWSCDLLCAASSPDLYRINLEQGRFLTSLST
KSPALNVVSRSKLHGLVACGGEDGAVECFDMRMKSSVGRINAVAPAGDIDQEVTALEFDE
DGGFLMAVGDSAGKGDGMTSIEPAAGIINDICVFRESGLILLALDGSQIPSYFVPALGPA
PKWCSYLENMTEELEEGAETSIYDDFKFLTIKDLERLNLQHLIGTNLLRAYMHGFFIDYR
LYKKAQSLADPFAYEAYIEQKKKEKMEAERASRITITKKLPKVNRELAAKIIESEAQEAE
VKDDDATDNQKKSSKRKKGLSNLDLNDERFADLFRNKDFEVVESSQEYRSLHPMPKKQPD
MVKEHFEPIMEEDEEQSDSDVSTASQSSDDYTNREKNNVKRPRLYEVKDERHADAFMNRV
STAAEDDLPLGERVAAASQDGHSSRISGKVKVGPGGSREISFVSRSSAKYKEDWEEEREA
KKRGIQSLGLKSDRSDFGGRGGRGRGGGGGRGRGRGRGRGGGGGRGRRGGGGGGGRGRGR
R
Download sequence
Identical sequences A0A2G5CRA0
Aquca_041_00065.2|PACid:22029324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]