SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_041_00144.1|PACid:22029203 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_041_00144.1|PACid:22029203
Domain Number 1 Region: 447-479
Classification Level Classification E-value
Superfamily WW domain 0.00000000876
Family WW domain 0.0017
Further Details:      
 
Domain Number 2 Region: 485-524
Classification Level Classification E-value
Superfamily WW domain 0.0000000101
Family WW domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_041_00144.1|PACid:22029203
Sequence length 722
Sequence
MDNFNSQPMPPGTQLYPNAFYNSAPLVPSVPQPHSFGNTPRLVNFYPNYSGNIQSPFPTC
NAPFPPGTQNFSTQFYPPEQHGLATHALNSSVQVPHNVPANVITQPSMPVFQSSGHLAPG
LVTPVGTGHDSMQPQVEASDSEFTTKNPQDGIASSSRSSLGPANRTSSLDVHQNEANNVS
QQMENSGQPEHATQVLKSCQDDRDTDYQSKELTEVSEDIVQQQKKQKVEEACNEVKSISV
NQTNENRYGWKSNHPQPSHSYSRLHGVGDKDVEDAAQDAVLREQEITTQQVIRDQRQAGV
ATGSLEDGKDIISGRYDPNALKEHLLKMTTDHRAEMASKRRKSSFPEKGNIEIGNGYGVP
GGSAGYGASKPSSNISAKSGGEIGDAHKLPEAENESGPRVSARDLPEYLKQKLKARGILK
DDSTKLGQAATENKFETQSSKTVAGAKLLPGWKEAKDPSTGSVYYYNENTGKSQWEIPFE
TPTIPQSAESLPLPPDWQEVVDVTTDHKYYYNMKTYVTQWERPSSVEEVALQQTGSLSRK
TAGETENISMQRKCMGCGGWGLGLVQASGYCNHCARVLNLPYHHLSPNLNNQQQISNGSK
MIEDSSSLASKHRSNSKPPMGKGGKKDYKKRSYTEDDELDPMDPSSYSDAPRGGWVVGLK
GVQPRAADTTATGPLFQQRPYPSPGAVLRKNAEVASQTKKPTSQFAAISKRGDGSDGLGD
AD
Download sequence
Identical sequences A0A2G5CQD4
Aquca_041_00144.1|PACid:22029203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]