SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_041_00148.2|PACid:22029155 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_041_00148.2|PACid:22029155
Domain Number 1 Region: 3-314
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.49e-72
Family WD40-repeat 0.0000946
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_041_00148.2|PACid:22029155
Sequence length 316
Sequence
MAETLTLRGTMRGHSDIVTAIATPIDNSDMIVSSSRDKSILVWHLTQEQDTYGVPKRRLT
GHSHFVQDVVLSSDGHFALSGSWDGELRLWDINTGATTRRFVGHAKDVLSVAFSIANRQI
VSASRDRTIKLWNTLGECKYTIQDGESHTNWVSCVRFSPNTFSPMIVSGSWDRTVKVWNL
TNCKIKNTLAGHTGYVNTVAVSPDGSLCASGGKDGVTLLWDLAEGKKLYSLEAGGIIHAL
CFSPNRYWLCAATEQSVKIWDLESKSVVQDLKIDLTTEKKQDNQVIYCTSLSWSADGSTL
FTGYTDGAIRVWTVGR
Download sequence
Identical sequences A0A2G5CQH5
Aquca_041_00148.2|PACid:22029155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]