SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_042_00062.3|PACid:22032891 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_042_00062.3|PACid:22032891
Domain Number 1 Region: 473-637
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 7.85e-69
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00000115
Further Details:      
 
Domain Number 2 Region: 182-381
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.04e-58
Family BC ATP-binding domain-like 0.00089
Further Details:      
 
Domain Number 3 Region: 84-179
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.88e-26
Family BC N-terminal domain-like 0.0037
Further Details:      
 
Domain Number 4 Region: 388-457
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.00000000000000369
Family BC C-terminal domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_042_00062.3|PACid:22032891
Sequence length 639
Sequence
MLLRCPSSAFYGHHRRDYIFGSGFKAPKTVEFAFPMEHITSGKNESRSSSLHMRKQISCC
QSSSINHEDLSRKDEFLVHGVSDTIVGVLGGGQLGRMLCQAASQMAIKVVILDPLESCPA
SALCYQHVVGSFDDSATVQNFAKRCGVLTVEIEHVDVATLEKLEQQGVDCHPKASTIRII
QDKYLQKAHFSKHGIPLPDFVEIDNFDSAKRAGDLFGYPLMIKSKRLAYDGRGNAVANNE
EEISSSVAALGGYGRGLYVEKWAPFVKELAVIVARGRDNSISCYPVVETIHSDNICHIVK
APADVPWKIRNLATDVAKKAVKSLDGAGVFAVELFLTKDDQILLNEVAPRPHNSGHHTIE
SCFTSQYEQHLRAVIGLPLGDSSMKTPAAIMYNILGEEEGELGFNLAHQLIKKALNISGA
SVHWYDKPEMRKQRKMGHVTIVGSSMGMVEAQLKSLLGKEELRLEDGTAATPSVGIIMGS
DSDLPIMKDAAKILDSFGVHYEVRIVSAHRTPSWMYTYAATARKRGIQVIIAGAGGAAHL
PGMVAAMTPLPVIGVPVRGSALDGTDSLLSIVQMPRGVPVATVAINNATNAALLAVRILG
LGNNDLQARLIQYQEDVGDDVLKKDEKLDKCGWEEYLNT
Download sequence
Identical sequences A0A2G5CQD3
Aquca_042_00062.3|PACid:22032891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]