SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_042_00062.4|PACid:22032892 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_042_00062.4|PACid:22032892
Domain Number 1 Region: 199-398
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.01e-58
Family BC ATP-binding domain-like 0.00089
Further Details:      
 
Domain Number 2 Region: 490-590
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 2.62e-45
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.0000115
Further Details:      
 
Domain Number 3 Region: 101-196
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.88e-26
Family BC N-terminal domain-like 0.0037
Further Details:      
 
Domain Number 4 Region: 405-474
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.00000000000000361
Family BC C-terminal domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_042_00062.4|PACid:22032892
Sequence length 627
Sequence
MHYKAKASSQSVVFFLLMLLRCPSSAFYGHHRRDYIFGSGFKAPKTVEFAFPMEHITSGK
NESRSSSLHMRKQISCCQSSSINHEDLSRKDEFLVHGVSDTIVGVLGGGQLGRMLCQAAS
QMAIKVVILDPLESCPASALCYQHVVGSFDDSATVQNFAKRCGVLTVEIEHVDVATLEKL
EQQGVDCHPKASTIRIIQDKYLQKAHFSKHGIPLPDFVEIDNFDSAKRAGDLFGYPLMIK
SKRLAYDGRGNAVANNEEEISSSVAALGGYGRGLYVEKWAPFVKELAVIVARGRDNSISC
YPVVETIHSDNICHIVKAPADVPWKIRNLATDVAKKAVKSLDGAGVFAVELFLTKDDQIL
LNEVAPRPHNSGHHTIESCFTSQYEQHLRAVIGLPLGDSSMKTPAAIMYNILGEEEGELG
FNLAHQLIKKALNISGASVHWYDKPEMRKQRKMGHVTIVGSSMGMVEAQLKSLLGKEELR
LEDGTAATPSVGIIMGSDSDLPIMKDAAKILDSFGVHYEVRIVSAHRTPSWMYTYAATAR
KRGIQVIIAGAGGAAHLPGMVAAMTPLPVIGVPVRGSALDGTDSLLSIVQARICCKTLIC
EEKERDEQEFIHSSNYNQRKDKKERRE
Download sequence
Identical sequences A0A2G5CP59
Aquca_042_00062.4|PACid:22032892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]