SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_042_00118.3|PACid:22033050 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_042_00118.3|PACid:22033050
Domain Number 1 Region: 232-617
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.01e-94
Family Regulator of chromosome condensation RCC1 0.00059
Further Details:      
 
Domain Number 2 Region: 13-123
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-24
Family Pleckstrin-homology domain (PH domain) 0.0032
Further Details:      
 
Domain Number 3 Region: 616-683
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.06e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_042_00118.3|PACid:22033050
Sequence length 905
Sequence
MGDPASYGNHERDIEQALIALKKGTQLLKYSRKGKPKFRPFRISSDETALIWYSHGEEKN
LKIASVSKIIPGQRTAVFRRFPRPEKDYLSFSLLYNNGERSLDLICKDKVETELWFAGLK
ALISVGQRNRRTRSDICDVHVGSDSLPNYRPFGATLEATSSFLRIAHSKSPSKSSDLCLR
EPPSNLTSSDVGSDSANMQLRTSTGDGYRLSISSAPSSSSQGSGPDDIESLGDVYVWGEV
WSDGSQAEGSLKPFPLQTDVLLPKALESDVVLDVHQIACGVRHAALVTRQGEVFTWGEEC
GGRLGHGIDKDFSRPRLVEFLAVNNVDYVGCGEYHTCAVSTTGDLFTWGDGTHNAGLLGH
GTNVSHWIPKRVTGPLEGVQVLSVACGTWHSALVTSNGKLYTFGDGTFGVLGHGSRDSVA
YPREIESLSGLKTIKVACGAWHTAAIVEVMGQLGANISPRKLFTWGDGDKNRLGHGDKET
RLVPTCIPSLIDYNFHQLACGYSITVALTTSGHVFTMGNTAYGQLGNPMSDGKSPCLVQD
KLMGESVEEISCGSYHVAVLTSRSEVFTWGKGANGRLGHGDIEDRRAPTLVETLKDRLVK
SISCGSNFTTSICIHKWVSGADQSVCTGCRQAFGFTRKRHNCYNCGLVHCHGCSSKKALR
AALAPTPGKPHRVCDSCHTKLRSSEAGNASTFNRKSVAPRRSIDNRERFDRGDIRSSKIL
LSSSAEPMNYVKAGTKSDFPLRVSQVPSLFQMKDVGVQSSQNTLQYALKPVITSAPQPVM
TPRSVSPYSRKPSPPRSATPVFSKSIIDSLKKTNELLNQEVLKLQSQVKNLRQKCEVQDV
ELQKCQKRAQDASSVAAEESSKSFLAKEVIKSVSTQVPLFTNHDILFIFNIGKLMSSSLS
PVCNG
Download sequence
Identical sequences A0A2G5CPN2
Aquca_042_00118.3|PACid:22033050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]