SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_042_00199.1|PACid:22032865 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_042_00199.1|PACid:22032865
Domain Number 1 Region: 8-125
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 6.02e-36
Family Ribosomal proteins L24p and L21e 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_042_00199.1|PACid:22032865
Sequence length 146
Sequence
MKYNPRVTSSRRKNRKAHFTAPSSVRRVIMSAPLSTDLRTKYNVRSIPIRKDDEVLITRG
TFKGREGKVVQVYRRKWIIHIERITREKVNGSTVNVGINPSKVVVTKLRLDKDRKSLLDR
KAKGRAASDKDKGTKFTTEEIMQNVD
Download sequence
Identical sequences A0A2G5CPR2
Aquca_042_00199.1|PACid:22032865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]