SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_043_00004.4|PACid:22045069 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_043_00004.4|PACid:22045069
Domain Number 1 Region: 352-492
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.31e-37
Family Pyk2-associated protein beta ARF-GAP domain 0.00029
Further Details:      
 
Domain Number 2 Region: 3-89,138-163
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.13e-27
Family BAR domain 0.009
Further Details:      
 
Domain Number 3 Region: 96-174,217-278
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-23
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 4 Region: 587-666
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.75e-23
Family Ankyrin repeat 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_043_00004.4|PACid:22045069
Sequence length 681
Sequence
MLEEELHSARSTFEQARFTLITALSNVEAKKRFEFLEAVSGTMDAHLRYFKQGYELLHQM
EPYINQVLTYAQQSRERSNYEQAALTERMQDYQRQIDRESRWSSNGSHGSPNGDGIQAIG
RSSHKMIEAVMQSAAKGKVQTIRQGYLSKRSSNLRGDWKRRFFVLDSRGMLYYYRKQWTK
PSGSGAQLSNHRSHSSELGSGLLSRWLSSHHRSGGGVHDEKSVAHHTVNLLTSTIKVDAD
QSDLRFCFRIISPSKNYTLQAESAMDQMDWIEKITGVIASLLSSQAPMQRLPLSPMRSGH
CHSPSESSSFESSSSFDHPTIEDFASEKNHITGHHERSGRSAHQHRLSMKSEKPIDVLRR
VCGNDRCADCGALDPDWASLNLGILVCIECSGVHRNLGVHISKVRSLTLDVKVWEPSVIT
LFQSLGNTYANSIWEELLNSRNTSLPDDSTTRSPLSDSHQLHPISKPSYSDPISIKEKFI
HAKYAEKLFVCKPKAQHLLSLANHMWDSVRTNDVKAVYRCIVNSETDVNAVHGQASISSS
LTLAKAMMLHEHPDHSSCLPEDSLDKPLGASSLNTVSTSGDKNVEECLDGCTLLHLACET
ADIGMIELLLQYGANVNAPDSRGQTPLHHCILRGRTVLAKLLLSRGADSRAIDRDGKTPL
LHASDLTLEDDEILSLLDTNR
Download sequence
Identical sequences A0A2G5CNA1
Aquca_043_00004.4|PACid:22045069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]