SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_043_00063.1|PACid:22044962 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_043_00063.1|PACid:22044962
Domain Number 1 Region: 54-190,324-453
Classification Level Classification E-value
Superfamily Pseudouridine synthase 3.6e-62
Family Pseudouridine synthase I TruA 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_043_00063.1|PACid:22044962
Sequence length 536
Sequence
MDSTTSPSSPKQEPEPEPVFKKLKMSTTTTTSDDDEPTTTITDPSSTDRKPRYKRRKIAI
FLAYCGVGYQGMQKNPGAKTIEGDLEEALYLAGGVPEHDRGKPKRFDWARSARTDKGVSA
VGQVVSGRFYIDPPGFIDRLNSILPNQIRIFGFKRTTSSFNAKKFCDRRRYVYLIPVFAL
DCNSHPDRESVLASLGSENELVKCLECSERGRKVAGAMGKHNNNAWKVDDNESKVELESG
DCLNNNGSSEIIVEIESGVSLNNNGIVAMEVKEENLSNEIKVELESGVSSNNDDIVAMEV
KDEKVGLDSVNVDEKGLSKKGSGFCYGEQEKERFNRILNSYVGTHNFHNFTTRIKAEDPS
AIRYIISFTANTVVTVDGIDFVKCEVVGQSFMLHQIRKLIGLAVAIMRNCAPESLIEYAL
QKDVNINVPTAPEVGLFLDECFFTSYNQKWKDTHEEISMEAYAEQAEDFKMKQVYSHIAS
MEQKEGSVAIWLHSLNYRNYPDLSYVGDTTPGNNGEKVHIDSIGEQVLAVEKSSTL
Download sequence
Identical sequences A0A2G5CNL5
Aquca_043_00063.1|PACid:22044962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]