SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_044_00008.1|PACid:22060403 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_044_00008.1|PACid:22060403
Domain Number 1 Region: 72-223
Classification Level Classification E-value
Superfamily Caspase-like 0.0000931
Family Caspase catalytic domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_044_00008.1|PACid:22060403
Sequence length 364
Sequence
MYNNMMLVNCTSCRTPLQIPPGAKSIRCSICQAITKIADPRDLPSTHNNNYQPTPYHPPP
PPSPSSHTPPGPPPSPHGRKKAVICGISYKFSRHELKGCINDAKCMRYLLMNRFKFPDAS
ILMLTEEETDPYRIPTKHNMRMALYWLVQGCQPGDSLVFHFSGHGSRQRNYNGDEMDGYD
ETLCPLDFETQGMIVDDEINTTIVKPLPRGVKLHAIIDACHSGTILDLPFLCRMNRSGHY
VWEDHRPRSGVWKGTNGGEAISFSGCDDDQTSADTSALSKITSTGAMTFCFIQAFEHGQG
ATYGSILNAMRTTIRNTGNGVGGGGPVNSLLTMLLTGGSGGGLRQEPQLTACEPFDVYTK
PFSL
Download sequence
Identical sequences A0A2G5CMJ1
Aquca_044_00008.1|PACid:22060403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]