SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_044_00078.2|PACid:22060445 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_044_00078.2|PACid:22060445
Domain Number 1 Region: 60-127
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 0.0000000000196
Family Ribosomal protein L29 (L29p) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_044_00078.2|PACid:22060445
Sequence length 144
Sequence
MFMVRVFRRTLFAAARSEPSNATAAAAASTKMTHNPLEAFFEADRNQEEEGKPVVYGRSW
KASEMRLKSWDDLQKLWYVLLKEKNMLMTQRQMLHAQNLRFPNPERIPKVRKSMCRIKHV
LTERAIDEPDARRSAEMKKMINAL
Download sequence
Identical sequences A0A2G5CN08
Aquca_044_00078.1|PACid:22060446 Aquca_044_00078.2|PACid:22060445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]