SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_045_00033.1|PACid:22027150 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_045_00033.1|PACid:22027150
Domain Number - Region: 270-352
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00254
Family Myosin rod fragments 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_045_00033.1|PACid:22027150
Sequence length 366
Sequence
MGSTGFSFGFSSSPSFFSNSSSSSSPSYVPPFSYPSFSSPTPTTPETTTSVGVTTTTVVP
FTFSTTSTINPSQPPQASVQINEEIDINQELSKPDEEQSQAKLPSKQQTKPMGKSQSVKK
ELQLKASETKSMGKSQSMKNELQLKAGESNDTDMVTELVNESGSDSLNNGFKFSLGELPN
GGGNIDAKDKSISFATEGIKKSERFGHTRILRGITQNPHYTPLQCYSKRAREKLIVGWDE
LFEETIDQIQSLTTETFSSNVGELWKTMAELENLGYNVARLKKRMDDLTDVINRRNTSQT
EISDLRTKAEDYKEQKKKIEKEIADLQAQADNTQIMVNELTDQVDKMEGNLPVVDALFES
VAVKSL
Download sequence
Identical sequences A0A2G5CLJ8
Aquca_045_00033.1|PACid:22027150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]