SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_045_00034.1|PACid:22027040 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_045_00034.1|PACid:22027040
Domain Number - Region: 97-163
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0175
Family Myosin rod fragments 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_045_00034.1|PACid:22027040
Sequence length 194
Sequence
MQRDSNGKERKETEEVKFEAPPTRSTEERLQTNGREMFLGITGIMQSITNEQQKAEFFFS
NVDELRKIIAEFEKVGCNGATHKKCVDAMESWMLFLREKQEAEEKLAHVDKRLAEAGLKL
AEEEELLAETEEELAHVGKRLAEAGLELAEEEELLAELNNALAEARLSRFFRYVLLFVCC
VVGCVLVEYLRQII
Download sequence
Identical sequences A0A2G5CMT2
Aquca_045_00034.1|PACid:22027040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]