SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_045_00057.3|PACid:22027154 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_045_00057.3|PACid:22027154
Domain Number 1 Region: 174-400
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.45e-33
Family WD40-repeat 0.0062
Further Details:      
 
Weak hits

Sequence:  Aquca_045_00057.3|PACid:22027154
Domain Number - Region: 109-131
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00445
Family Retrovirus zinc finger-like domains 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_045_00057.3|PACid:22027154
Sequence length 436
Sequence
MPPQTRRMSFPRVVIERDTDSEESSSSEEEEENLPPEEEEEEEEEEEEFLENEIEEKVEE
DCVVEEQEKKKKGKVPITISLKKVCKVCKRTGHEAGFKGATYIDCPMKPCYLCKMPGHTT
MTCPYRVSMEHGVVPAPKRNTRSPLDFVFERQIKSNVSTIKPAFVIPNQIDCAVIRYHSR
RITCLEFHPTNNNILLSGDKKGQLGVWDYDKVHDKTVYGNIHSCILNNMRFNPANDGTLY
AASSDGTISCTDLESGMSSSLMDVNPDGWQGANTWRMLYGMDINPDKGLVLVADNFGCLY
MVDVRSHNKTGEAILIHKKGTKVVGLQCNPVQPELLLSCGNDHFARIWDMRKLEAGSSLA
DLPHRRVVNSAYFSPQSGCKILTTAQDNRIRIWDSIFGDLETPSREIVHSHDFNRHLTPF
RAEWDPKVINSTFIMN
Download sequence
Identical sequences A0A2G5CMY0
Aquca_045_00057.3|PACid:22027154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]