SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_045_00060.1|PACid:22027272 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_045_00060.1|PACid:22027272
Domain Number 1 Region: 63-276
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000733
Family WD40-repeat 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_045_00060.1|PACid:22027272
Sequence length 833
Sequence
MKFNFDLTKTESPSDKQADLTTPSPPPRRPTPPPPPESFLPPPPYQQKEEIEWMLLQNHP
VFTNTITTTTSSSNSKNVHKNLIAWDVRASRLYYWDQNKQCLHRISIRLGDPEPTNVIAA
SPSKVLQSDIPVDFIVDYISINKNGSAMLLSGSDGLRVMFLYGKTSNKDNSIICRTVSVG
APIYFDNSTPIRTLQISWHPYSDTHLGILSSDSVFRMYDLSSDLEKPEQEYYLQPVEPGR
SHSAASTCPVGFSFGGEHLWDRFSVFVLFSDGSIYLLCPVVPIGSAYRWEAIVEIYNDAH
TFGLKSSNSRAVSNSSLAIAWLESTFPEITHQDSGGTSIMLRAQLYVPFDASLCLQGPLC
KVCHGEEDDGFESQGSKCEGRAVSFLYNSISKDSVLVTAYSSGQLQIDALADEIQPVWIV
GSAPRLSVNSHDQIHGFAMICESNTDDFSVVKLHQPLDQHVWLGHSPPLLRLAIVDLALP
RHTDSDSLLSLFADPLIPERIFCMHGGGVDSIVLHFLPFTSQTTGKDESVRAPSVYPVFS
TCHGHNYLPSPLSGFVALADPFGYSWIVGVTSSRECIVLETKGWDARLPHHIDWEKFTSD
EVQDVDTPDIISKELLSGPKVVLVPQASPNLRAVTADSIEGRSALHQYFKLFQENYVEYA
HKVWFELKDHGAHLKRIVDDQHGRLGEVHQRLLNIEEKQPKLENRINRAVEVNKHLEERL
RTLRNLPGARKKPLSRSEREFKAELDRFTGLELDALRSSIETLSARLRKHSQSSKSNASS
SPKQMPGRRKNHIPDPQISDLLSAVKKLSLVNSENTQKVKLVESALQSKESST
Download sequence
Identical sequences A0A2G5CLN8
Aquca_045_00060.1|PACid:22027272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]