SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_045_00061.1|PACid:22027239 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_045_00061.1|PACid:22027239
Domain Number 1 Region: 94-154
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0000000000000265
Family Ribosomal protein L14e 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_045_00061.1|PACid:22027239
Sequence length 199
Sequence
MAPTTTKKARVTRNPELIRGVGKYSRSEMYHKRGLWAIKQKNGGTFPHHETEPAKQKPIV
KAPKFYPAEDVKKPLVNKRKPKPTKLRASITPGTGKRVVFVKQRASGLLLVTGPFKINGV
PLRRVNQAYLIATSTKVDISGINAAEKEEKNVLPQEKKDDQKVVDAALLKLIEAVPDLKS
YLAARFSLKSGMKPHELVF
Download sequence
Identical sequences A0A2G5CLP6
Aquca_045_00061.1|PACid:22027239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]