SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_045_00116.1|PACid:22026951 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_045_00116.1|PACid:22026951
Domain Number 1 Region: 41-166,198-217,248-300,483-575
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.74e-28
Family WD40-repeat 0.031
Further Details:      
 
Domain Number 2 Region: 504-711
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000797
Family WD40-repeat 0.025
Further Details:      
 
Domain Number 3 Region: 1052-1107
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000012
Family SNARE fusion complex 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_045_00116.1|PACid:22026951
Sequence length 1116
Sequence
MFAKRLLQKVKNNNSSSSNQNNLPHGNLKSTDLNPHISLHYGVPSTASVLAFDPIQRLLA
IGTLDGRIKVIGGDNIEGLLISPISLPYKSLEFLQNQGFLVSVSNGNDIQVWDLEHRCIA
SSLKWESNITAFSVICNTSFMYVGDEFGLMCVLKYDAEEGKLLQLPYHVPATSLTEASAV
SQSYHESIVGILPQPCTSGNRVLIAYESGLIILWDISEAQIVVVRGNKDLQLDDEGFDTS
PSAANDEPPDTTHSIQEEKEISSLCWASSSGTILAVGYVDGDIMLWNLSSSAINANQQAG
RSPNGVVKLQLSSAKRRIPVIVLHWAADSQSNNNCRGQLFIYGGDEIGSEEVLTVLSLEW
SSGIQTLRCVGRVDLTLAGSFADMILIPKAGSVENDVSGDLFVLTNPGNLHVYRDANLST
LASDSENASSLPAIPFPVVIPMTDPVLTASKLSVISKGENSPKALLEIASIMRTGASPAI
AADPKWPLTGGVPSQLSFAEDKTVGRIYITGYGDGSVRIWDATYPVLSLILGLKDEALST
KDAQANSPVTALDFCSLSTSLAVGNKSGLVSVFKFYGSSEDTSFHFVTETEHEVRSVHQT
KGLQCFAVFSLLSSPVQTLQYDSSGVKLAVGYECGRVAVLDVSTSSVLFLTDCASSSSSP
VMSIVLDTFSDIGNLKSPKHSGSKNLKEPAESLAFILTRDSHVIVLNSMTGNMIIPRAMH
PKTESSAISLHVIEHITLVSEASDEKEPENISQDSVTHIEPVKPIIGTEAKCDEVELHSS
KETAYSREKLSDSFVLLCSKTALRLYTLKSLLQGNKKSIRKVKLGKPCCWATTIRKKGES
ACGLILLYETGVIEIRSLPDMELVSESSLMSILRWSFKANMNKTMSSSENGLIALANGCE
LAFISFLDGGNDFRIPESLPCLHDNVLAAAADAAISLSSKQKKKQGTAPGILGGIIKGFK
GKKMSYTENSNEDLPKSPHLDSIFSTVPFSDPSPDIGDHQEVELDIDDIEIEEPVAVASS
SYVGKNIKSEREKLFEGANEDIKPRLRTQEEIIAKYRKAGDVSAVAAQAKDKLLQRQEKL
ERISRRTEELQNGAENFASMANELVKAMEARKWYHI
Download sequence
Identical sequences A0A2G5CLY1
Aquca_045_00116.1|PACid:22026951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]