SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_045_00158.2|PACid:22027259 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_045_00158.2|PACid:22027259
Domain Number 1 Region: 16-293
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.96e-38
Family WD40-repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_045_00158.2|PACid:22027259
Sequence length 338
Sequence
MMENSTQESNPRSENVFTHDSPYPIYAMAFSSSSSDKSHRIAVGSFLEDLNNKVDILSFD
EETSIFGTHPDLSFDHPYPPTKLMFHPKPQSSPDLLASSGDFLRLWEIKDNSSIEQKLVL
NNSKTSEFCAPLTSFDWNQVEPRRIGTSSIDTTCTIWDVERGVVETQLIAHDKEVYDIAW
GEAGVFASVSADGSVRVFDLRDKEHSTIIYESPQPDTPLLRLAWNKQDLRYMATILMDSN
KVVILDIRSPTIPVAELDRHRASVNAISWAPHSSRHICSAGDDAQALIWELPTVAGPDGI
DPMLAYSSVSEINQLQWSVLQPDWIAIAFASKMQLFKV
Download sequence
Identical sequences A0A2G5CM44
Aquca_045_00158.1|PACid:22027260 Aquca_045_00158.2|PACid:22027259 Aquca_045_00158.3|PACid:22027258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]