SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_045_00205.1|PACid:22027110 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_045_00205.1|PACid:22027110
Domain Number 1 Region: 55-114
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 3.01e-18
Family eIF5a N-terminal domain-like 0.0028
Further Details:      
 
Domain Number 2 Region: 119-181
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.42e-17
Family Cold shock DNA-binding domain-like 0.007
Further Details:      
 
Domain Number 3 Region: 181-238
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000223
Family Cold shock DNA-binding domain-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_045_00205.1|PACid:22027110
Sequence length 238
Sequence
MAGIAAATINISVSSSSCFRSSSSVSFSPKLSFCPMRAFPKLSSRSRFQRIYAFSSNDIK
VGSNIEVDGAPWRVLEFLHVKPGKGAAFVRTKMRNYVTGNTVQKTFRAGSTIQEADIVKE
TKQYTYKDGNQFVFMDLSTYEEIRLNASDVGDKTKWLKEGTDCNVLFWNGKVIDFDLPIN
VKLSVVSVDPGLKGDTAQGGGSKPATVDTGAIVYVPLFVNTGDEIVVDTRTGQYMNRA
Download sequence
Identical sequences A0A2G5CMH1
Aquca_045_00205.1|PACid:22027110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]